Recombined Template REC-0-1_002

Consensus Sequence

DNLVMTQTPKFLLVTPGEPATITLRSSQSLLNENGYNYKYWYQKKPGQSPQLLIYQASTRASGVPDRFGSPRYGTGGSDFISRVQAEDLAVPECHQDLQSPTFGAGTKLEIKTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPRLAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFGRNEC

Annotated Consensus Sequence

ConsensusTemplate

N.N

LIL

TST

KLK

FSF

LPL

TST

LCL

CDR1SS

NHN

ESE

KLK

YDY

QLQ

KQK

QLQ

CDR2AGA

TNT

GSSGGS

PSP

RGR

YSY

GDG

GFG

STS

DLD

FKF

QEQ

LVL

AGA

PYP

EYE

HMH

CDR3QQ

DAD

STS

AQA

LEL

GNG

NGN

Legend

CDRConservedPossible glycosylation site

Sequence Consensus Overview

LQVNL

LPA

PVA

VLNMTM

NTA

KGLFLF

FLA

SLV

SLT

ALG

NSAE

RLP

LST

PGLVT

RAQFPSTA

MQFGNL

DNLAR

PDVNES

PEYQNLGS

AGTVWLHPQNT

AGLPTSA

KMCHL

CGSL

DHKLNSNH

VYSENSA

CHGNA

VSKRMYWG

FSKAPY

EFLDN

MQSY

LRK

DHY

QKQ

HLYKA

GQGAN

GNQ

STS

PSLTA

AGPSR

YFLA

ATS

RKTV

SGP

ASGD

KGRFR

QYFA

HES

TYSRGP

GAR

VTY

VPT

HSDG

KAYG

FRS

NRLAPTD

PDVAF

QSTL

HLMS

NLMAR

YVDL

NFLQA

GHV

LFYP

GSFAYE

ETC

MVDFH

DVYEPQ

YSHAD

SYL

LGPYSQ

LPDS

VKLP

LFGF

GQA

AQA

SGA

QVT

GKE

LAK

SLATSL

SNVLQA

ESD

KLEQE

FEQA

LKL

LKA

QGAS

STA

FAV

TSC

MDGGN

EGRL

PRA

VNFQ

TEKGQW

ALV

QEGD

NGQ

VNQAA

ALDN

DVS

KGQ

GVDE

EAGS

GVD

SKS

SNKA

NYD

QTS

TNS

LNS

NDT

LTL

TGLA

YHLAED

GCKY

DLSEGVT

MKA

VYV

VYA

SGA

DSGC

SYDE

YLV

GTS

GSFGF

RTNGA

YEGN

0
1	L	1	0.98075	QV	2	0.761795	NL	2	12.224967164772728
2	L	1	0.599842	P	1	0.9999
3		0	1	NG	2	1
4	L	1	0.61095	P	1	0.99974	V	1	14.818031140151513
5	D	1	0	V	1	0.99312	L	1	0.99898	N	1	1.1414499999999999	M	1	11.64017089141414	TM	2	0.923395
6	L	1	0	D	1	0.94015	S	1	0.96061	K	1	0.9781	N	1	1.39829	T	1	16.611842318181814
7	N	1	0	T	1	0	V	1	0.19295	D	1	0.32551	M	1	0.46387	H	1	0.63732	E	1	0.69113	Q	1	11.60820221554834
8	H	1	0	K	1	0	L	1	0.20991	S	1	0.21855	T	1	19.834586306637803
9	L	1	0	P	1	22.65128326857865
10	N	1	0.86611	V	1	0.94246	K	1	20.741096879329003
11	P	1	0	N	1	0.29006	K	1	0.60405	G	1	0.63297	L	1	0.80709	F	1	5.6446009226190474	LF	2	1.7440666666666669
12	F	1	1.3018866666666666	L	1	4.530238303571428
13	F	1	1.8694799999999998	L	1	5.180992833333334
14	S	1	0.79016	L	1	0.799921	V	1	2.4822699999999998
15		1	0	S	1	0.98677	L	1	1.799862	T	1	1.99965
16		1	0	N	1	0.91545	P	1	2.74998
17		1	0	A	1	0.61664	L	1	0.931	G	1	2.79964
18		1	0	G	1	0.18254	N	1	0.92008	S	1	0.97971	A	1	0.98569	E	1	5.4783007857142865
19		1	0	R	1	0.50596	L	1	0.799999	P	1	8.540959285714287
20	E	1	0	L	1	0.99489	A	1	11.050455261904762
21	G	1	0	K	1	0.666015	L	1	0.9926	S	1	3.7945	T	1	8.541517857142857
22	P	1	0.94221	G	1	5.5467329761904764	L	1	8.58967	VT	2	0.91188
23	E	1	0.17522	R	1	0.80049	A	1	0.95199	Q	1	0.99513	F	1	0.99949	P	1	0.99999	S	1	4.31385	T	1	4.4786295238095235
24	K	1	0		1	0	Y	1	0	C	1	0.40299	M	1	0.98452	Q	1	1.5236271428571428	F	1	1.5248599999999999	G	1	1.8309533333333334	N	1	1.9348699999999999	L	1	3.8976599999999997
25		1	0	E	1	0.35459	D	1	0.951	N	1	0.97617	L	1	0.99999	A	1	2.3712299999999997	R	1	6.240030476190476
26		1	0	M	1	0.12005428571428571	W	1	0.27325750000000004	R	1	0.32181	P	1	0.61155	D	1	0.64959	V	1	0.8019	N	1	1.09527	E	1	1.55588	S	1	6.080027500000001
27		1	0	V	1	0.19676	D	1	0.21632	T	1	0.43009	M	1	0.45508	P	1	0.62437	E	1	0.80705	Y	1	0.90152	Q	1	0.94903	N	1	0.99941	L	1	0.99992	G	1	1.71788	S	1	2.43029
28		1	0	E	1	0.07122	S	1	0.39765	AG	1	0.942585	T	1	0.94623	V	1	0.99982	W	1	1.3696774999999999	L	1	1.58983	H	1	1.68663	P	1	1.9977900000000002	Q	1	2.7623699999999998	NT	2	1.29513
29	E	1	0		1	0	D	1	0	C	1	0.5	A	1	0.79496	G	1	0.9989	L	1	0.99999	P	1	1	T	1	1.97399	S	1	8.649525
30	E	1	0		1	0	D	1	0.65654	S	1	0.8117	K	1	0.98233	M	1	0.99581	C	1	0.99685	H	1	0.99932	L	1	12.403220000000003
31	F	1	0		1	0	K	1	0.09525	C	1	0.86718	G	1	0.99395	S	1	0.99994	L	1	12.29578
32	Q	1	0		1	0	D	1	0.93647	H	1	1.84672	K	1	1.99798	L	1	1.99817	N	1	5.719670000000001	SNH	3	0.8464899999999999
33	G	1	0	C	1	0		1	0	M	1	0	Q	1	0.08075	V	1	0.75937	Y	1	1.66177	S	1	4.43628	E	1	4.49898	NS	2	0.9986550000000001
34	D	1	0.18298666666666666	C	1	0.82242	H	1	0.9793	G	1	0.9983	N	1	9.131797499999998
35	F	1	0	V	1	0.79794	S	1	0.87494	K	1	0.91737	R	1	0.9818	M	1	0.99975	Y	1	1	W	1	3.9965725	G	1	5.567056666666666
36	E	1	0	M	1	0.05356	F	1	0.44638	S	1	0.531	K	1	0.77008	A	1	0.84858	P	1	0.99262	Y	1	3.7921633333333333
37	E	1	0.31902	F	1	0.67528	L	1	0.9349	D	1	1.18399	N	1	1.59169
38	V	1	0	M	1	0.14482	Q	1	0.47985	S	1	0.8818	Y	1	0.99918
39	L	1	0.96264	R	1	0.98454	K	1	0.99983	DL	2	0
40	D	1	0.89474	H	1	0.99701	Y	1	0.99969
41	M	1	0	T	1	0.99958	W	1	1.0046599999999999
42	Q	1	0	G	1	0.99987	Y	1	6.307143333333333
43	E	1	0	Q	1	8.03676818181818	KQ	2	0.6134678571428571
44	A	1	0	H	1	0.88192	L	1	0.99938	Y	1	1.2246966666666668	K	1	8.212361515151516
45		1	0	S	1	0	GL	1	0.909295	L	1	0.96139	Q	1	1.1550833333333332	A	1	1.36368	K	1	25.725737556277057
46		1	0	S	1	0.24722666666666668	Y	1	0.32953	D	1	0.7771	F	1	0.91823	P	1	35.61713563419914	GP	2	1.5621099999999999
47		1	0	Q	1	0.56273	L	1	0.94492	A	1	0.97611	G	1	35.72141775757576	QG	2	5.77394277056277	AN	2	5.973584999999999	SGQ	3	0.9485325
48	AG	1	0		1	0	C	1	0.19782	N	1	0.33707	L	1	0.89196	T	1	0.9098	P	1	0.99954	Q	1	29.757431348484843	SQ	2	0.13629000000000002
49	K	1	0.31656	Y	1	0.59229	A	1	0.63236	R	1	0.8079	Q	1	0.98517	W	1	0.99131	T	1	2.3118966666666667	S	1	47.180540865800864
50	S	1	0.33331	E	1	0.39059	Q	1	0.39428250000000004	H	1	0.68884	L	1	0.75634	G	1	1.47675	P	1	55.96264225108226	LPQ	3	0.7127033333333334
51	R	1	0	S	1	0.17055	P	1	0.31816	L	1	0.33116666666666666	A	1	0.45196	N	1	0.66025	G	1	0.99838	D	1	1.2764933333333333	E	1	1.75553	GA	1	1.8400150000000002	Q	1	42.60080196103897	AAV	2	0.49991416666666666	LQ	2	0.928145
52	P	1	0	D	1	0.00015333333333333334	V	1	0.2195	Q	1	0.60308	R	1	1.1611366666666667	A	1	1.34788	K	1	1.96436	L	1	52.21908608008657
53	Q	1	0	R	1	0.18206	T	1	0.498375	Y	1	0.62183	A	1	0.8821	N	1	1.69581	L	1	56.839769378787885
54		1	0	A	1	0.49794249999999995	G	1	0.55478	Q	1	0.7931666666666666	Y	1	1.4459175	L	1	51.116910090909094
55		1	0	A	1	0.46291	T	1	0.7998179999999999	N	1	0.90578	D	1	0.95958	S	1	0.98778	L	1	0.99912	E	1	0.99983	P	1	0.99993	G	1	1.99845	Q	1	3.779546515151515	Y	1	40.47564674025974
56		1	0	H	1	0.32308	K	1	0.84252	V	1	0.93376	M	1	0.9555	P	1	0.99968	W	1	0.99993	G	1	2.90163	N	1	3.225295	Q	1	35.434533168831166
57	T	1	0		1	0	Y	1	0.11351	F	1	0.35823099999999997	W	1	0.59497	E	1	0.69138	R	1	0.71851	S	1	0.74101	Q	1	0.9691	H	1	0.98891	K	1	0.99977	V	1	1.564014	P	1	1.64458	A	1	34.57584595021645	SA	2	0.67151	GT	2	1.70821
58		1	0	G	1	0.89053	T	1	0.96801	E	1	0.97076	P	1	1.24795	V	1	1.69791	L	1	1.96608	S	1	29.183913119047627	TS	2	3.3086800000000003	TRS	3	0.5935166666666667
59	A	1	0		1	0	V	1	0.18228	Q	1	0.2327825	K	1	0.5088	M	1	0.5397	R	1	0.70097	C	1	0.99818	D	1	1.05013	P	1	1.81396	S	1	3.0425319999999996	L	1	3.9495364545454548	T	1	18.79215088744589	RT	2	0.72689
60	L	1	0		1	0	E	1	0.12729	Q	1	0.1934	GL	1	0.60616	N	1	0.98442	D	1	0.98503	A	1	2.385975	G	1	2.80514	P	1	2.9514801515151516	S	1	4.01269	R	1	21.76330063636364	AR	2	0.14834333333333335
61		1	0	N	1	0.05015	K	1	0.52051	H	1	0.67812	R	1	0.82721	Y	1	0.9448342857142856	F	1	0.99998	L	1	2.8121686969696973	A	1	10.4931275	TG	2	0	SQ	3	0.25094500000000003
62		1	0	N	1	0.04733	G	1	0.8178018181818182	V	1	0.96749	A	1	2.672715	T	1	6.574670978835979	S	1	8.288436666666666	GS	2	0.227645
63		1	0	T	1	0.3328233333333333	N	1	0.788903	R	1	0.86455	K	1	0.94854	A	1	0.99226	S	1	0.99976	F	1	1	Q	1	1.4379454545454546	G	1	13.824123439153439
64		1	0	S	1	0	N	1	0.16031333333333334	Q	1	0.6569699999999999	A	1	0.89479	R	1	0.99792	K	1	1	T	1	1.5480183636363636	V	1	13.420759391534391
65	L	1	0		1	0	C	1	0.06571	S	1	0.99956	G	1	0.99999	P	1	16.160226774891775
66		1	0	L	1	0.57516	A	1	0.99851	S	1	0.99993	G	1	0.99997	D	1	14.247156265031265
67		1	0	K	1	0.99818	G	1	0.99999	R	1	8.928993879268877	FR	2	1.567835	GRF	3	0.6440966666666667
68		1	0	G	1	0	L	1	0	Q	1	0.70435	Y	1	1.8258800000000002	F	1	2.96258
69		1	0	L	1	0	Q	1	0.11716	Y	1	0.27463	G	1	5.30182
70		1	0	G	1	0	L	1	0.03842333333333333	H	1	0.99976	E	1	1.92847	S	1	4.828707499999999
71		1	0	L	1	0	C	1	0.33329333333333333	LG	1	0.4873475	T	1	0.88109	Y	1	0.99965	S	1	1.51735	R	1	1.93184	G	1	1.9937200000000002	P	1	1.99999
72		1	0	GL	1	0.28059666666666666	G	1	0.99953	A	1	1.99619	R	1	4.30509
73	V	1	0.52734	T	1	1.9682499999999998	Y	1	4.317395
74	C	1	0.33199666666666666	G	1	8.214938333333334
75	G	1	0.32663333333333333	V	1	0.7155100000000001	P	1	0.93066	T	1	4.595933333333334
76	L	1	0.11918333333333332	H	1	0.47992250000000003	S	1	0.8333333333333334	D	1	1.6550500000000001	G	1	3.9890800000000004
77	K	1	0.58662	A	1	0.77668	Y	1	0.97098	G	1	6.351286136363637
78	E	1	0.07928	W	1	0.184275	F	1	0.8181245454545455	R	1	0.99569	S	1	5.828716666666667
79	N	1	0.8149527272727273	R	1	0.83398	L	1	0.96653	A	1	0.9997	P	1	1.8332333333333333	T	1	2.28788	D	1	2.38119
80	R	1	0.12218	P	1	0.8180445454545455	D	1	0.99113	V	1	0.99496	A	1	2.1400633333333334	F	1	3.0853500000000005
81	Q	1	0.79544	S	1	0.99964	T	1	1.8314633333333332	L	1	5.70345
82	H	1	0.92177	L	1	1.8309733333333333	M	1	2.98822	S	1	4.695682727272727
83	N	1	0.38315	L	1	0.47488	M	1	0.9288	A	1	1.9994	R	1	2.637443333333333
84	L	1	0.42556	Y	1	0.99314	V	1	7.354853333333334	DL	2	0.57785
85	N	1	0.76506	F	1	0.99887	L	1	1.4134233333333333	Q	1	5.8021199999999995
86	A	1	7.97327
87	Q	1	0.02849	T	1	0.99894	E	1	5.55492
88		1	0	V	1	0.99865	D	1	4.692159999999999
89		1	0	Q	1	0.12041	V	1	0.99981	L	1	4.92023
90	G	1	1.8851233333333333	A	1	5.98547
91	K	1	0.06772	G	1	0.33165	H	1	0.71658	V	1	4.791449999999999
92	L	1	0.41894	F	1	0.92549	Y	1	2.142643333333333	P	1	2.87832
93	D	1	0.08068	G	1	0.57441	S	1	0.93432	F	1	0.96191	A	1	0.9891	Y	1	1.3585541666666665	E	1	1.6214499999999998
94	Y	1	0.1841	Q	1	0.25485	E	1	0.47304	T	1	0.7136	C	1	6.127392500000001
95	E	1	0.09597	M	1	0.9700675	V	1	0.9956849999999999	D	1	1.01179	F	1	1.08466	H	1	5.116070000000001
96	D	1	0.86892	V	1	0.99854	Y	1	0.99861	E	1	1.4496	P	1	3.502766666666667	Q	1	5.05138
97	G	1	0	N	1	0.11181	K	1	0.56109	Y	1	0.9862	S	1	1.18017	H	1	1.33102	A	1	4.372065	D	1	4.75331
98	N	1	0.16971	D	1	0.92444	S	1	1.85204	Y	1	6.99017	L	1	8.674234963427377
99	A	1	0	L	1	0.99855	G	1	0.99936	P	1	1	Y	1	1.9881	S	1	5.5092300000000005	Q	1	7.799461789446187
100		1	0	H	1	0.99996	W	1	1	L	1	1.99999	P	1	4.662758333333333	D	1	5.559190376175549	S	1	7.73721
101		1	0	V	1	1.6644966666666667	K	1	3.7393532601880874	L	1	6.5789100000000005	P	1	8.98452
102		1	0	M	1	0	D	1	0.99097	E	1	0.99405	A	1	1	L	1	1.6451525	T	1	22.810191270712043
103	G	1	0.85308	V	1	0.98184	R	1	0.99568	S	1	1.1360166666666667	L	1	2	F	1	19.940768591269844	GF	2	3.450427946708464
104	M	1	0.42006	G	1	23.278354226190476	Q	2	2.937061111111111	NA	3	0.731
105	H	1	0.90056	W	1	0.97276	T	1	0.99924	L	1	1.1145391666666666	A	1	18.08480505952381	Q	2	1.52257
106	T	1	0.01524	N	1	0.9999	P	1	1	S	1	1.6666666666666665	G	1	25.79760011904762	AS	2	0	SA	2	0	KGT	3	0.8159666666666666
107	N	1	0.9486	S	1	1.39113	Q	1	3.75293	V	1	4.413996666666667	T	1	19.046387738095238
108	L	1	1	K	1	31.904007341269846	LK	2	0.6295299999999999
109	A	1	0.6666666666666666	S	1	1.32668	L	1	23.161310317460316	EL	2	0.56005
110		1	0	N	1	0.28099	S	1	0.6666666666666666	L	1	0.81987	G	1	1.98679	K	1	2.98411	E	1	15.043666706349203
111		1	0	K	1	0.82904	Q	1	0.95813	V	1	0.96411	P	1	0.98095	S	1	1	L	1	22.566594642857144
112		1	0	N	1	0.37102999999999997	GL	1	0.756805	VA	1	0.84771	G	1	0.85099	Q	1	0.98763	P	1	1	L	1	2.51472	A	1	3.6009	K	1	13.454868857142856
113		1	0	K	1	0.64778	G	1	0.9203	N	1	1	S	1	1.44465	L	1	3.535024	A	1	3.94899	T	1	11.831609583333332	SL	2	2.142818888888889
114		1	0	Q	1	0.19957	K	1	0.20687	T	1	0.2935703333333334	G	1	0.31956	A	1	0.33689	D	1	0.64864	S	1	1.73885	N	1	2.07006	V	1	15.977850797619046	QL	3	0.3278183333333333	LQ	3	1.74756
115		1	0	R	1	0	L	1	0.18849	Q	1	1	A	1	48.929260892857144
116		1	0	R	1	0.98093	T	1	0.99972	N	1	1.9781499999999999	A	1	50.73407010714287	PSA	3	0.4427461111111111
117	L	1	0	T	1	0.90121	K	1	0.99548	V	1	1.99609	P	1	60.300402646825376
118	Q	1	0	A	1	0.16937	E	1	0.3330166666666667	G	1	0.39879	T	1	0.43762	S	1	59.39429434523809	VS	2	0.987195
119	P	1	0	F	1	0.10528	E	1	0.35033	D	1	0.87797	R	1	0.99792	V	1	61.32019538492062
120	A	1	0	V	1	0.3333333333333333	P	1	0.5474	D	1	0.7912589999999999	Y	1	0.82831	M	1	0.962855	R	1	3.13826	F	1	60.390077361658435
121	P	1	7.25376	L	1	36.31641278981938
122	Q	1	0		1	0	T	1	0.33138	D	1	0.4648	P	1	0.6666666666666666	L	1	0.7979029999999999	F	1	37.432534880952375	PF	2	0.33282500000000004
123	K	1	0.33259	F	1	0.3333333333333333	S	1	0.6666666666666666	N	1	0.7808430000000001	Y	1	0.99378	G	1	1.9794999999999998	P	1	40.22639604269295
124	V	1	0.06953	E	1	0.32924333333333333	T	1	0.5185	A	1	0.6666666666666666	Q	1	0.786097	L	1	0.99095	G	1	1.99006	P	1	38.45057472495895
125		1	0	Y	1	0.00485	E	1	0.766251	A	1	0.78475	T	1	0.99926	V	1	0.99965	M	1	1.10184	N	1	1.51974	S	1	36.443521978653536
126		1	0	Q	1	0.03121	K	1	0.32459	T	1	0.38983	G	1	0.68625	A	1	0.79494	L	1	0.79974	N	1	0.81525	V	1	1	F	1	1.2863033333333334	E	1	1.7900800000000001	S	1	1.9999799999999999	D	1	23.66137616995074	ED	2	1
127		1	0	G	1	0.33142333333333335	N	1	0.62105	Q	1	0.92989	A	1	1.16904	V	1	1.31808	K	1	2.21244	L	1	2.9032999999999998	E	1	24.37743425123153	QE	2	3.4917233333333333	QLE	3	0.5486766666666667
128		1	0	K	1	0.04778	D	1	0.2740666666666667	M	1	0.9671933333333333	L	1	0.99986	G	1	1.0781800000000001	F	1	1.682455	E	1	2.27783	Q	1	24.70278263546798
129	H	1	0.70896	R	1	0.71375	N	1	0.81196	A	1	0.99983	E	1	1.63839	G	1	1.98081	L	1	37.55732188957307	KL	2	2.7718175243506495
130		1	0	P	1	0.72454	W	1	0.78715	N	1	0.97599	F	1	0.99973	T	1	1	Q	1	1.0049000000000001	S	1	1.3331	L	1	3.0755583333333334	K	1	29.422243546798033
131	C	1	0.3313466666666667	R	1	0.44687	E	1	0.98527	Q	1	1.37623	T	1	7.668856666666667	S	1	89.7821677540944	GS	2	4.927834999999999	GTS	3	3.154176666666667
132	S	1	0.99979	V	1	0.99994	E	1	2.3134333333333332	A	1	2.946319350649351	Q	1	5.9363166666666665	G	1	72.45200739267283	SA	2	1.8035750000000002	AS	2	9.362819305555558
133	L	1	0	E	1	0.10472333333333333	A	1	0.10770666666666667	N	1	0.94575	F	1	0.99843	V	1	1.15064	S	1	9.864500000000001	T	1	64.43918041249512
134	G	1	0.32591	E	1	0.98791	P	1	1.9998399999999998	V	1	8.011800000000001	A	1	98.82931674166588	GT	2	3.3118149999999997	VGT	3	0.8186444444444444
135		1	0	F	1	0	N	1	0.44194	A	1	0.651	G	1	0.98891	D	1	0.99363	R	1	0.99992	T	1	1.7779099999999999	E	1	1.9218600000000001	S	1	101.00301010627169	VS	2	0.42099
136		1	0	Q	1	0.09434	L	1	1.7527899999999998	G	1	4.999900409090909	F	1	7.509029724025974	A	1	13.911090000000002	V	1	83.46479598718606
137		1	0	N	1	0.01953	E	1	0.18306	C	1	0.25184	D	1	0.43832	M	1	0.7545	K	1	0.89347	R	1	0.997	S	1	0.99746	A	1	1.47715	F	1	1.93065	T	1	2.33488	H	1	2.46928	G	1	2.48856	L	1	2.9492545454545454	V	1	89.42071213637922	AM	2	0.877985	MA	2	1.348135
138		1	0	Y	1	0.23892	F	1	0.42063	Q	1	0.4549	H	1	0.69332	K	1	1.33212	D	1	1.5832233333333332	E	1	1.90153	A	1	1.99719	R	1	2.98081	G	1	4.216343333333333	N	1	4.33071	L	1	5.029754727272727	T	1	5.14194	S	1	17.242647473684208	C	1	53.10780445751635
139		1	0	G	1	0.04105	K	1	0.116	H	1	0.12326	M	1	0.34173	A	1	0.5506	T	1	0.5644566666666666	S	1	0.88578	P	1	0.94134	F	1	1.17424	V	1	2.1340000000000003	D	1	2.1500666666666666	E	1	2.33680697368421	N	1	2.4281833333333336	L	1	71.71568586757279
140		1	0	F	1	0.4437	M	1	0.46198	N	1	0.50796	T	1	0.89262	H	1	0.99971	V	1	1.05914	E	1	1.2712966666666667	Y	1	1.2863833333333334	R	1	1.78283	P	1	2.98975	L	1	100.06110207063513	VAG	2	0	VQ	2	0.9780249999999999	QV	2	1
141		1	0	M	1	0.26088	G	1	0.3957633333333333	P	1	0.99831	L	1	0.99934	S	1	1	T	1	1.8620700000000001	V	1	1.9476200000000001	GG	1	2.142525	E	1	3.33917	D	1	22.7517895	N	1	62.83221354653077
142		1	0	E	1	0	R	1	0.85033	T	1	0.98906	A	1	1	L	1	1.05793	C	1	1.1802199999999998	G	1	1.3332366666666666	K	1	1.84785	S	1	1.99323	V	1	2.38218	P	1	2.78704	M	1	6.11106	D	1	7.65023	GG	1	8.316876666666667	N	1	58.03782374381296	FN	2	1.11841
143		1	0	Q	1	0.06934	H	1	0.12063	K	1	0.13315	N	1	0.23992	Y	1	0.44296	L	1	0.66718	S	1	0.99989	W	1	0.99995	A	1	1	V	1	1.0623066666666665	D	1	1.35946	P	1	1.5700233333333333	E	1	1.9382700000000002	T	1	2.7301576363636366	M	1	4.29779	F	1	66.5947032205661	YF	2	1.2575100000000001
144		1	0	K	1	0.04959333333333333	N	1	0.21471	A	1	0.6010613636363636	P	1	0.90119	L	1	0.95176	W	1	0.96295	C	1	0.99347	T	1	0.99728	H	1	2.2562266666666666	M	1	3.3778300000000003	Y	1	87.42780399574428
145		1	0	L	1	0.07098	M	1	0.23113	E	1	0.24831	D	1	0.8423700000000001	H	1	0.99061	G	1	0.9987	Q	1	1.53932	P	1	87.96378275787018	RP	2	1.68326
146		1	0	F	1	0.18092	G	1	0.7931	V	1	0.83278	K	1	0.85417	W	1	0.8601	D	1	0.88556	E	1	0.98104	A	1	0.99154	S	1	2.9809200000000002	T	1	7.421274	R	1	74.3805403583763
147		1	0	P	1	0.21178	E	1	0.9144950000000001	G	1	0.99944	R	1	2.48474	L	1	11.0685947
148		1	0	T	1	0.15625	E	1	0.16482	N	1	0.35750000000000004	Q	1	0.42133000000000004	Y	1	0.63392	P	1	0.99976	R	1	1.5866099999999999	A	1	10.092461833333335
149		1	0	P	1	0.36553	N	1	0.48659600000000003	R	1	0.6561699999999999	L	1	3.51864	K	1	8.3415889
150		1	0	A	1	0.40373000000000003	V	1	18.203854771929826
151		1	0	D	1	0.86273	V	1	1.83224	N	1	2.98806	F	1	3.7466711000000004	Q	1	9.575432105263157
152		1	0	T	1	0.66755	E	1	0.693125	K	1	0.98653	G	1	0.99904	Q	1	1.9455786842105265	W	1	7.82668
153		1	0	V	1	0.09504	D	1	0.20288	G	1	0.78052	K	1	18.184328048245614
154		1	0	Q	1	0.37338	N	1	0.64091	K	1	0.91607	Y	1	0.95525	S	1	1.5672630263157896	A	1	1.99077	L	1	4.11177	V	1	24.276409956709962
155	C	1	0	L	1	0		1	0	N	1	0.00031	S	1	0.05895	W	1	0.71971	Y	1	0.7278294078947367	A	1	1.81324	Q	1	2.5178700000000003	E	1	3.7050000000000005	G	1	4.76281	D	1	20.89444213852814	ND	2	1.457705
156		1	0	Y	1	0.61798	Q	1	0.71172	D	1	0.89467	L	1	0.98153	P	1	0.99999	E	1	1.27887	G	1	1.51535	M	1	1.85248	N	1	25.700469796992486	QG	2	0.97392	GQ	2	2.3033241666666666
157	E	1	0		1	0	H	1	0.042890000000000005	T	1	0.99705	V	1	1.91056	N	1	2.27489	Q	1	4.1806600000000005	A	1	21.159467454545457
158		1	0	V	1	0.07383	E	1	0.54794	A	1	0.80325	S	1	0.99781	L	1	46.640793389610394
159	L	1	0	A	1	0		1	0	D	1	0.53717	H	1	0.82168	E	1	0.857	N	1	0.9838	AG	1	1	V	1	1.26879	C	1	2	Q	1	34.618057290043296
160	P	1	0	C	1	0		1	0	D	1	0.9666	K	1	0.975	N	1	0.99171	G	1	0.99998	V	1	1.8225799999999999	E	1	1.9289399999999999	A	1	2.52542	S	1	32.65601264502164	GS	2	0.951065
161		1	0	E	1	0.71258	N	1	0.84999	V	1	0.94672	D	1	0.99621	L	1	0.99775	S	1	1.98311	G	1	31.482700155844153
162	K	1	0	GG	1	0.5132950000000001	F	1	0.51523	G	1	0.64378	Q	1	0.90418	V	1	0.97128	R	1	0.99282	S	1	1.98259	P	1	1.99371	A	1	2.2209000000000003	L	1	3.77258	D	1	5.253450000000001	N	1	20.063887623376626	SN	2	0.6123350000000001
163	G	1	0.234	H	1	0.51442	E	1	0.66714	Q	1	0.81419	T	1	0.84647	K	1	0.99399	Y	1	2.16831	D	1	2.2516800000000003	V	1	2.98774	S	1	30.942369588744587	NT	2	0.5163	QS	2	0.9281550000000001
164		1	0	D	1	0.09419	T	1	0.44708	H	1	0.70558	E	1	0.8578899999999999	L	1	0.95961	V	1	0.99983	A	1	0.99995	R	1	1.09353	K	1	1.82267	G	1	2.4705	Q	1	19.780016419913423
165	Y	1	0.62032	M	1	0.65289	S	1	0.97701	A	1	0.98424	H	1	0.99933	L	1	1.38757	G	1	2.32202	V	1	3.73899	D	1	4.03554	E	1	25.45874616883117	SE	2	1.3471899999999999
166	N	1	0.56927	T	1	0.99135	Q	1	1.08319	L	1	1.98021	E	1	2.39204	A	1	2.4345	G	1	3.9035599999999997	S	1	29.687604419913423
167	Q	1	0.33858	S	1	0.36425	K	1	0.37285	H	1	0.4641	T	1	0.99887	D	1	1.4395	E	1	1.57376	V	1	38.21625100541126
168	F	1	0.97487	D	1	0.99918	P	1	1.99992	S	1	2.6923725000000003	T	1	44.752994770562786	ET	2	0.991805
169	Q	1	0.02749	A	1	0.96676	D	1	0.99634	S	1	0.99951	T	1	0.99999	L	1	1.55855625	H	1	1.99989	V	1	2.0379766666666668	Y	1	2.98254	E	1	35.006711787878785
170	AG	1	0.99363	A	1	0.99551	L	1	0.99905	D	1	0.99942	S	1	0.99999	V	1	1.99977	Q	1	40.68542308008658	EN	2	1.13259
171		1	0	M	1	0.86533	Q	1	0.96149	S	1	0.99997	H	1	0.99999	N	1	1.2436386666666668	G	1	2.6271899999999997	V	1	4.284330000000001	D	1	30.52286859848485
172		1	0	Q	1	0	E	1	0.22772	T	1	1.61486	G	1	1.92634	L	1	2.64837	V	1	2.9996	S	1	50.01555676190476	KS	2	5.559103333333333
173		1	0	Q	1	0.11437	L	1	0.33051	VA	1	0.9837400000000001	T	1	0.99987	A	1	0.99997	P	1	0.99998	R	1	1.44858	D	1	1.8311433333333333	Y	1	1.86383	V	1	1.96639	S	1	3.35236	N	1	3.6364566666666667	K	1	33.98021404761906
174		1	0	T	1	0	Q	1	0.06861	A	1	0.43363	S	1	0.75662	E	1	0.97374	L	1	0.99772	P	1	0.99982	G	1	0.99998	V	1	1.98232	N	1	3.06727	Y	1	4.049635	D	1	34.70978895833332
175		1	0	A	1	0.3654	Y	1	0.4453	T	1	0.8483	Q	1	0.96767	M	1	0.98254	V	1	0.99963	D	1	1.12725	F	1	1.7201225	E	1	1.92179	N	1	2.165563333333333	L	1	4.53156	S	1	35.95813416666667
176		1	0	Y	1	0.15359	N	1	0.42495	A	1	0.70447	D	1	1.32408	E	1	1.37199	K	1	1.7655766666666666	L	1	1.9844	F	1	1.9904600000000001	S	1	4.420393333333333	T	1	38.07870854166668
177		1	0	V	1	0.80065	A	1	0.84548	N	1	0.85502	Q	1	0.90469	R	1	0.96428	F	1	0.97452	E	1	0.99956	D	1	2.20819	L	1	9.040996666666665	Y	1	37.897404166666654	SY	2	0.8765050000000001
178		1	0	K	1	0.74566	D	1	0.90363	V	1	0.95284	R	1	0.95678	Q	1	3.9495700000000005	T	1	10.136086666666667	S	1	32.60479708333333
179		1	0	F	1	0	E	1	0.53879	K	1	0.8131	H	1	0.98114	Y	1	0.99916	G	1	2.74624	L	1	46.45263145833333
180		1	0	A	1	0	D	1	0	P	1	0.19324	L	1	0.31856	E	1	0.32804	K	1	0.61336	Q	1	0.64519	G	1	0.99835	H	1	0.99954	T	1	4.86412	N	1	11.346295	S	1	34.73930312499999
181		1	0	Q	1	0	D	1	0.10777	M	1	0.31073	E	1	0.7041758333333333	G	1	0.95453	A	1	0.99719	P	1	1	Y	1	1.19482	L	1	4.878406666666667	N	1	9.489348333333332	S	1	32.808683333333335	TS	2	0.2958
182		1	0	F	1	0	Q	1	0.1496	V	1	0.32846	M	1	0.45395	L	1	0.599926	S	1	0.74473	Y	1	1.50824	G	1	1.9764300000000001	P	1	1.99945	N	1	2.6983550000000003	D	1	10.241021666666665	T	1	27.2537525
183	V	1	0		1	0	R	1	0.08216	E	1	0.11375	M	1	0.1387	G	1	0.7418	Y	1	0.8332591666666667	T	1	0.98162	A	1	0.98769	S	1	1	D	1	1.48055	N	1	1.9837099999999999	L	1	43.761927125	TL	2	3.36902375
184	V	1	0		1	0	F	1	0	E	1	0.52309	A	1	0.5995940000000001	P	1	0.94208	N	1	0.97603	C	1	0.99829	H	1	1.71558	L	1	1.97193	D	1	2.1200675	K	1	3.3137533333333336	T	1	56.142834136904774
185	Q	1	0	A	1	0.161	E	1	0.46944600000000003	D	1	0.53499	N	1	0.72164	G	1	0.7619366666666667	C	1	1	F	1	1.9931999999999999	S	1	1.99996	L	1	64.77172818452381	SL	2	0.7268950000000001
186	M	1	0.09615	D	1	0.25305	F	1	0.2705	K	1	0.4961125	G	1	1	V	1	1.55627	E	1	1.8857833333333334	T	1	1.96912	Q	1	2.93769	L	1	14.603853333333337	S	1	45.463596160714275	KS	2	0.88249
187		1	0	W	1	0	R	1	0.9359	N	1	0.99251	V	1	1	G	1	1.53229	D	1	1.669	T	1	1.93307	L	1	1.95652	K	1	50.35857297023809
188		1	0	C	1	0	Y	1	0	S	1	0.58792	E	1	0.74384	H	1	0.98998	K	1	0.99974	Q	1	1.8118699999999999	T	1	2.43938	G	1	2.76411	L	1	3.97347	A	1	24.143134011904767	DA	2	0.661475
189		1	0	C	1	0.2137	Q	1	0.289512	Y	1	1.64705	H	1	1.85373	L	1	1.9976099999999999	A	1	2.3673599999999997	E	1	3.6372799999999996	D	1	15.91421660714286
190	E	1	0.86379	F	1	0.91094	N	1	0.98696	V	1	1.0929	G	1	1.78809	C	1	1.9998200000000002	K	1	2.56413	Y	1	16.87169613095238
191		1	0	M	1	0.26687	Q	1	0.68617	K	1	0.77301	W	1	0.88321	A	1	0.94161	V	1	0.99308	D	1	1.19354	L	1	1.30412	S	1	2.16602	E	1	9.930083583333332	GVT	2	1.7302
192		1	0	Q	1	0.11376	E	1	0.20839	V	1	0.71003	Y	1	0.88954	G	1	0.90851	A	1	0.97587	L	1	0.98723	T	1	1	M	1	1.87982	K	1	15.282612499999997
193		1	0	N	1	0.01776	G	1	0.8567	L	1	0.95506	K	1	0.9836	A	1	0.99667	P	1	1	W	1	1.27427	D	1	1.95324	H	1	28.87781916666666
194		1	0	D	1	0.45194	N	1	0.60519	AV	1	0.99881	Y	1	0.9991	G	1	1	C	1	1.64147	V	1	1.9818099999999998	K	1	29.84010875
195	N	1	0	P	1	0.40243	T	1	0.85333	A	1	0.99951	V	1	100.13267763888886	YV	2	5.81211
196	F	1	0.34103	H	1	0.475	N	1	0.63487	T	1	0.98478	E	1	1.62901	G	1	1.98858	A	1	2.99604	P	1	4.77516	V	1	6.23394	Y	1	79.30819527777777
197		1	0	N	1	0.52175	D	1	0.9346099999999999	H	1	0.98489	Y	1	1	V	1	1.34834	M	1	1.94888	E	1	2.86088	T	1	4.3611699999999995	S	1	7.85224	G	1	11.71259	A	1	69.67022416329965
198	N	1	0.32550999999999997	F	1	0.41364	A	1	0.90524	Q	1	1.27802	V	1	1.99301	H	1	2.35933	P	1	2.55916	T	1	2.88069	M	1	2.8822900000000002	L	1	3.51607	E	1	3.7952800000000004	Y	1	4.19815	D	1	6.399830000000001	S	1	9.951589999999998	G	1	14.200070000000002	C	1	29.17800116161616	EC	2	0.7070000000000001
199	F	1	0.19407	C	1	0.26705	P	1	0.54624	N	1	0.57001	H	1	0.84548	L	1	0.86783	T	1	0.97078	M	1	1.11097	G	1	1.36729	V	1	2.38514	Q	1	2.63103	A	1	2.7198325	S	1	3.79186	Y	1	4.577990000000001	D	1	5.27846	E	1	42.3626441161616	DL	2	1.191655
200		1	0	D	1	0.25528	A	1	0.31601999999999997	G	1	0.38059	H	1	0.56122	T	1	0.7297	N	1	0.91923	P	1	0.9774	S	1	1.09731	C	1	1.18248	Q	1	2.1907400000000004	M	1	2.38517	E	1	2.6685575000000004	F	1	2.86448	Y	1	4.16384	L	1	4.4549408333333345	V	1	40.881464562289565	SL	2	0.316865
201	E	1	0	S	1	0.09575	H	1	0.21599000000000002	C	1	0.47825	W	1	0.58675	M	1	1	L	1	1.46977	A	1	1.83467	Y	1	1.9984899999999999	D	1	3.9793600000000002	T	1	110.59308143265993
202	V	1	0		1	0	L	1	0.85807	G	1	0.99972	D	1	3.6037000000000003	H	1	121.99417467673942	QH	2	0.89062	GHQ	3	0
203	T	1	0	A	1	0.02505	L	1	0.28409666666666666	C	1	0.93161	E	1	0.96895	Q	1	124.96682113881816	AN	2	0.9980899999999999	GQ	2	1.1049449999999998
204	K	1	0	E	1	0.51649	T	1	0.80282	L	1	1	S	1	2.9924399999999998	D	1	5.524052345938375	G	1	122.84707714646461	VA	2	0.340592
205	Q	1	0.05952333333333334	P	1	0.99997	V	1	1.82679	K	1	2.46145	Y	1	5.761354464285715	S	1	6.9854	L	1	110.50674735858581	VT	2	0.9918750000000001	SL	2	4.78109
206	V	1	0	E	1	0.39405	T	1	0.99358	L	1	0.99994	S	1	122.46573563076461
207		1	0	R	1	0.89781	Q	1	0.96986	E	1	0.99832	T	1	1.52114	F	1	1.5332293333333336	L	1	2	S	1	106.71071850903176
208	G	1	0.99451	K	1	0.99959	L	1	1	Q	1	3	E	1	3.31812	P	1	124.27148142157188
209	A	1	0.99953	Q	1	1	T	1	1.5258639999999999	D	1	2.0611699999999997	K	1	3.62291	L	1	5.740589623015873	V	1	115.91480348096347
210	L	1	0.9932	A	1	1	D	1	1	T	1	119.69261065057165	KT	2	2.6232949999999997
211	E	1	0.91827	G	1	0.92666	F	1	3.3268629761904758	K	1	109.93438620745917
212	G	1	1	T	1	1	S	1	9.970420576923075
213	L	1	0.46871	G	1	0.9742	S	1	1.9997099999999999	F	1	6.327817499999999	GF	2	2
214	R	1	0.98867	T	1	1.13643	N	1	1.4965875	G	1	3.0373099999999997
215	P	1	0.53584	R	1	6.543172499999999
216	Y	1	0.22361	E	1	0.4371	G	1	1.0584475	N	1	1.63471
217	E	1	5.568202500000001
218	C	1	6.6449475

Variant Graph

Determine stroke width:

LocalGlobal

Higher Order Variant Graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

1st order support

Higher order graph

Depth of Coverage of the Consensus Sequence

Label	Value
"0"	0
""	14
""	14
""	16.4
""	15.7
""	20.9
""	13.9
""	20.3
""	22.7
""	22.5
""	9.72
""	5.83
""	7.05
""	4.07
""	4.79
""	3.67
""	4.35
""	8.55
""	9.85
""	12
"20"	14
""	16
""	13.7
""	12.1
""	11.9
""	11.5
""	10.7
""	14.1
""	14.9
""	17.8
""	15.3
""	13.3
""	12.4
""	12.1
""	15.1
""	7.43
""	4.7
""	2.51
""	2.95
""	2.89
"40"	2
""	7.31
""	8.65
""	11.3
""	30.1
""	39.5
""	50.9
""	33.2
""	53.8
""	60.7
""	51.8
""	57.5
""	60.7
""	54.4
""	53.4
""	46.6
""	46.3
""	40.8
""	32.5
""	37
"60"	17.6
""	19.6
""	21.2
""	18.7
""	18.2
""	17.8
""	13.1
""	5.49
""	5.69
""	7.8
""	10.1
""	7.58
""	6.81
""	8.55
""	6.57
""	7.08
""	8.69
""	7.91
""	10.1
""	8.15
"80"	9.33
""	10.4
""	6.42
""	9.35
""	8.98
""	7.97
""	6.58
""	5.69
""	6.04
""	7.87
""	5.91
""	6.37
""	6.52
""	7.75
""	9.27
""	12.9
""	13.3
""	18.6
""	18.3
""	22
"100"	21
""	27.4
""	29.4
""	27.4
""	23.6
""	30.3
""	29.6
""	33.5
""	25.7
""	21.8
""	27.3
""	24.4
""	25.5
""	23.9
""	50.1
""	55.1
""	64.2
""	61.7
""	63.7
""	67
"120"	43.6
""	40
""	45.3
""	43.8
""	42.6
""	34.6
""	37.9
""	32
""	47.2
""	39.3
""	109
""	96.8
""	77.6
""	114
""	109
""	112
""	110
""	101
""	85.5
""	114
"140"	98.5
""	96.7
""	85.5
""	98.7
""	94.6
""	91.2
""	15.7
""	14.4
""	13.4
""	18.6
""	19
""	13.1
""	19.3
""	34.8
""	36.7
""	37.8
""	30.6
""	49.1
""	42.1
""	43.8
"160"	38
""	40.4
""	43.9
""	30.2
""	42.5
""	43
""	43.8
""	52.4
""	47.6
""	48.8
""	42.5
""	65
""	52.5
""	49
""	52
""	52.2
""	56.4
""	50.2
""	52.5
""	55
"180"	52.7
""	48
""	55.5
""	69.3
""	73.1
""	71.4
""	60.4
""	39.1
""	27.9
""	27.1
""	20.9
""	23
""	36.9
""	37.5
""	108
""	99.4
""	103
""	87.5
""	71.7
""	66.3
"200"	122
""	128
""	129
""	134
""	134
""	125
""	115
""	134
""	131
""	125
""	115
""	12
""	11.8
""	6.66
""	7.08
""	3.35
""	5.57
""	6.64

Scores

Length	Score	Matches	Unique Score	Unique Matches
218	6.471E+04	858	5.102E+04	556

Order

IGKV2-28 → IGKJ2 → IGKC

Alignment

10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 180 190 200

DINVMTQTP-KFLLVTPGEPASISCRSSQSL-LHSNG-YNYLDWYQKKPGQ-S-PQL--L--IY--Q---ASTRASGVPDRFGSRRYGTDGSTFISRVEAEDVGVYYCM-QALQT--P-TFGAGT-KLEIK-T-V-AA--PSVFI--FPPSDE-QLK-SGT-ASVV--C--L--L--NNF-Y-PRLAKVQWKVDNALQS-GNSQE-SV-TEQDSK-DSTY-SL--SS--T-LT-L-SKAD-YE-KHKVYA--C--E--V--T-HQGL-SSPVT--K-SFGRNEC

Combined

Type	Read
Score	62
Start on Template	1
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_009

Type	Read
Score	136
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_091

Type	Read
Score	101
Start on Template	44
Length on Template	16
Start on Read	0
Length of Read	16
Unique	No
Positional Score
Alignment graphic

C116

Type	Read
Score	100
Start on Template	46
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_038

Type	Read
Score	101
Start on Template	44
Length on Template	16
Start on Read	0
Length of Read	16
Unique	No
Positional Score
Alignment graphic

Combined_044

Type	Read
Score	112
Start on Template	46
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_067

Type	Read
Score	42
Start on Template	61
Length on Template	6
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C61_002

Type	Read
Score	75
Start on Template	153
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_225

Type	Read
Score	126
Start on Template	114
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C910

Type	Read
Score	65
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C62

Type	Read
Score	104
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C119

Type	Read
Score	109
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C121_002

Type	Read
Score	109
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_3132

Type	Read
Score	102
Start on Template	46
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C224_002

Type	Read
Score	272
Start on Template	153
Length on Template	34
Start on Read	0
Length of Read	34
Unique	Yes
Positional Score
Alignment graphic

C668

Type	Read
Score	104
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C723

Type	Read
Score	69
Start on Template	114
Length on Template	16
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_221

Type	Read
Score	56
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C507

Type	Read
Score	45
Start on Template	157
Length on Template	17
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

C704

Type	Read
Score	116
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_171

Type	Read
Score	114
Start on Template	114
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_110

Type	Read
Score	38
Start on Template	211
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

C73_003

Type	Read
Score	39
Start on Template	53
Length on Template	10
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

Combined_112

Type	Read
Score	55
Start on Template	3
Length on Template	7
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C108_003

Type	Read
Score	70
Start on Template	60
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C124_002

Type	Read
Score	29
Start on Template	55
Length on Template	5
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C143_003

Type	Read
Score	116
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C144_002

Type	Read
Score	115
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_088

Type	Read
Score	151
Start on Template	153
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_124

Type	Read
Score	33
Start on Template	178
Length on Template	6
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

Combined_1731

Type	Read
Score	44
Start on Template	1
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C191_004

Type	Read
Score	107
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1102

Type	Read
Score	107
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C347

Type	Read
Score	96
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1751

Type	Read
Score	126
Start on Template	44
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C465

Type	Read
Score	43
Start on Template	46
Length on Template	17
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

Combined_150

Type	Read
Score	46
Start on Template	174
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_151

Type	Read
Score	55
Start on Template	111
Length on Template	12
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_1531

Type	Read
Score	43
Start on Template	177
Length on Template	9
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

Combined_1532

Type	Read
Score	36
Start on Template	12
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

Combined_155

Type	Read
Score	85
Start on Template	46
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C619

Type	Read
Score	57
Start on Template	157
Length on Template	21
Start on Read	0
Length of Read	21
Unique	No
Positional Score
Alignment graphic

Combined_156

Type	Read
Score	36
Start on Template	204
Length on Template	7
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_212

Type	Read
Score	98
Start on Template	45
Length on Template	15
Start on Read	0
Length of Read	19
Unique	No
Positional Score
Alignment graphic

Combined_182

Type	Read
Score	118
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_172

Type	Read
Score	79
Start on Template	116
Length on Template	14
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1277

Type	Read
Score	134
Start on Template	113
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1289

Type	Read
Score	93
Start on Template	130
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_169

Type	Read
Score	128
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1374

Type	Read
Score	87
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1447

Type	Read
Score	95
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_1712

Type	Read
Score	110
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1466

Type	Read
Score	71
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1494

Type	Read
Score	49
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C136_003

Type	Read
Score	70
Start on Template	60
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C182

Type	Read
Score	44
Start on Template	197
Length on Template	14
Start on Read	0
Length of Read	16
Unique	No
Positional Score
Alignment graphic

Combined_1523

Type	Read
Score	160
Start on Template	153
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C197_002

Type	Read
Score	44
Start on Template	1
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_1601

Type	Read
Score	109
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_1103

Type	Read
Score	97
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C491_002

Type	Read
Score	116
Start on Template	44
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C651

Type	Read
Score	116
Start on Template	45
Length on Template	15
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C896

Type	Read
Score	133
Start on Template	130
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1490

Type	Read
Score	122
Start on Template	113
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1546

Type	Read
Score	143
Start on Template	112
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_227

Type	Read
Score	39
Start on Template	196
Length on Template	15
Start on Read	0
Length of Read	15
Unique	No
Positional Score
Alignment graphic

C1426

Type	Read
Score	105
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_228

Type	Read
Score	110
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1567

Type	Read
Score	62
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C127

Type	Read
Score	87
Start on Template	60
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C166_004

Type	Read
Score	104
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C206_002

Type	Read
Score	43
Start on Template	177
Length on Template	17
Start on Read	0
Length of Read	16
Unique	No
Positional Score
Alignment graphic

C309_002

Type	Read
Score	124
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C346_002

Type	Read
Score	118
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_1461

Type	Read
Score	109
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C358

Type	Read
Score	97
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C455

Type	Read
Score	41
Start on Template	149
Length on Template	13
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

C468

Type	Read
Score	96
Start on Template	45
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C475

Type	Read
Score	50
Start on Template	164
Length on Template	23
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C625_002

Type	Read
Score	55
Start on Template	157
Length on Template	20
Start on Read	0
Length of Read	21
Unique	No
Positional Score
Alignment graphic

Combined_1455

Type	Read
Score	45
Start on Template	27
Length on Template	17
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

C815

Type	Read
Score	111
Start on Template	130
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C877

Type	Read
Score	133
Start on Template	130
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C895

Type	Read
Score	88
Start on Template	195
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1116

Type	Read
Score	110
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1156_002

Type	Read
Score	88
Start on Template	116
Length on Template	14
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_2804

Type	Read
Score	79
Start on Template	116
Length on Template	14
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1472

Type	Read
Score	47
Start on Template	121
Length on Template	23
Start on Read	0
Length of Read	19
Unique	No
Positional Score
Alignment graphic

C1501

Type	Read
Score	83
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1581

Type	Read
Score	105
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1587

Type	Read
Score	105
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_351

Type	Read
Score	29
Start on Template	149
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

Combined_293

Type	Read
Score	29
Start on Template	149
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

Combined_353

Type	Read
Score	30
Start on Template	97
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

Combined_407

Type	Read
Score	36
Start on Template	130
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C268_003

Type	Read
Score	29
Start on Template	146
Length on Template	5
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C299_002

Type	Read
Score	40
Start on Template	130
Length on Template	14
Start on Read	0
Length of Read	14
Unique	No
Positional Score
Alignment graphic

Combined_2775

Type	Read
Score	36
Start on Template	56
Length on Template	7
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

Combined_251

Type	Read
Score	29
Start on Template	146
Length on Template	5
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

Combined_314

Type	Read
Score	29
Start on Template	146
Length on Template	5
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

Combined_323

Type	Read
Score	51
Start on Template	171
Length on Template	15
Start on Read	0
Length of Read	15
Unique	No
Positional Score
Alignment graphic

Combined_344

Type	Read
Score	47
Start on Template	89
Length on Template	16
Start on Read	0
Length of Read	16
Unique	No
Positional Score
Alignment graphic

Combined_256

Type	Read
Score	34
Start on Template	128
Length on Template	8
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

Combined_1904

Type	Read
Score	36
Start on Template	56
Length on Template	7
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C466_002

Type	Read
Score	32
Start on Template	28
Length on Template	8
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

Combined_455

Type	Read
Score	38
Start on Template	128
Length on Template	8
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

Combined_496

Type	Read
Score	35
Start on Template	166
Length on Template	9
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C1908

Type	Read
Score	43
Start on Template	202
Length on Template	11
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

Combined_360

Type	Read
Score	49
Start on Template	112
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_413

Type	Read
Score	33
Start on Template	128
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

Combined_476

Type	Read
Score	39
Start on Template	25
Length on Template	10
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C2014_002

Type	Read
Score	25
Start on Template	78
Length on Template	6
Start on Read	0
Length of Read	6
Unique	No
Positional Score
Alignment graphic

Combined_454

Type	Read
Score	51
Start on Template	61
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C263_004

Type	Read
Score	36
Start on Template	130
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

Combined_411

Type	Read
Score	36
Start on Template	128
Length on Template	8
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C773_002

Type	Read
Score	47
Start on Template	166
Length on Template	19
Start on Read	0
Length of Read	20
Unique	No
Positional Score
Alignment graphic

Combined_420

Type	Read
Score	78
Start on Template	1
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_3540

Type	Read
Score	47
Start on Template	175
Length on Template	11
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

Combined_495

Type	Read
Score	64
Start on Template	205
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C891_002

Type	Read
Score	40
Start on Template	130
Length on Template	14
Start on Read	0
Length of Read	14
Unique	No
Positional Score
Alignment graphic

C1913_002

Type	Read
Score	38
Start on Template	25
Length on Template	10
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

Combined_568

Type	Read
Score	33
Start on Template	166
Length on Template	8
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C160_007

Type	Read
Score	128
Start on Template	152
Length on Template	25
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C84_007

Type	Read
Score	33
Start on Template	196
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C126_004

Type	Read
Score	29
Start on Template	105
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C793_003

Type	Read
Score	47
Start on Template	21
Length on Template	16
Start on Read	0
Length of Read	16
Unique	No
Positional Score
Alignment graphic

C1715

Type	Read
Score	35
Start on Template	25
Length on Template	10
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C52_005

Type	Read
Score	77
Start on Template	183
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C75_007

Type	Read
Score	38
Start on Template	46
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_570

Type	Read
Score	62
Start on Template	196
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C83_006

Type	Read
Score	30
Start on Template	200
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C180_002

Type	Read
Score	139
Start on Template	152
Length on Template	25
Start on Read	0
Length of Read	26
Unique	Yes
Positional Score
Alignment graphic

Combined_630

Type	Read
Score	36
Start on Template	46
Length on Template	11
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C66_006

Type	Read
Score	81
Start on Template	183
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_666

Type	Read
Score	66
Start on Template	1
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C665_004

Type	Read
Score	41
Start on Template	173
Length on Template	12
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_3241

Type	Read
Score	35
Start on Template	153
Length on Template	10
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

Combined_631

Type	Read
Score	72
Start on Template	196
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_633

Type	Read
Score	120
Start on Template	196
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_635

Type	Read
Score	156
Start on Template	157
Length on Template	20
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

Combined_1104

Type	Read
Score	35
Start on Template	201
Length on Template	8
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

Combined_982

Type	Read
Score	45
Start on Template	104
Length on Template	16
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C632_002

Type	Read
Score	53
Start on Template	162
Length on Template	26
Start on Read	0
Length of Read	27
Unique	No
Positional Score
Alignment graphic

Combined_638

Type	Read
Score	42
Start on Template	201
Length on Template	10
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

Combined_3163

Type	Read
Score	29
Start on Template	146
Length on Template	5
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C1299

Type	Read
Score	47
Start on Template	171
Length on Template	15
Start on Read	0
Length of Read	15
Unique	No
Positional Score
Alignment graphic

C51_006

Type	Read
Score	60
Start on Template	183
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C79_008

Type	Read
Score	31
Start on Template	112
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C310_002

Type	Read
Score	43
Start on Template	30
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_957

Type	Read
Score	42
Start on Template	114
Length on Template	19
Start on Read	0
Length of Read	15
Unique	No
Positional Score
Alignment graphic

C77_006

Type	Read
Score	60
Start on Template	196
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C239_008

Type	Read
Score	149
Start on Template	196
Length on Template	22
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C1839_004

Type	Read
Score	43
Start on Template	25
Length on Template	10
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

Combined_3710

Type	Read
Score	35
Start on Template	17
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

Combined_2144

Type	Read
Score	41
Start on Template	73
Length on Template	12
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

Combined_691

Type	Read
Score	36
Start on Template	135
Length on Template	7
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_2364

Type	Read
Score	35
Start on Template	17
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C290_007

Type	Read
Score	41
Start on Template	73
Length on Template	12
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

C168_008

Type	Read
Score	40
Start on Template	69
Length on Template	13
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

Combined_767

Type	Read
Score	36
Start on Template	174
Length on Template	8
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C1315_005

Type	Read
Score	39
Start on Template	202
Length on Template	12
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

Combined_3450

Type	Read
Score	32
Start on Template	27
Length on Template	8
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C2236

Type	Read
Score	48
Start on Template	174
Length on Template	13
Start on Read	0
Length of Read	14
Unique	No
Positional Score
Alignment graphic

Combined_3517

Type	Read
Score	29
Start on Template	134
Length on Template	6
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

Combined_1282

Type	Read
Score	37
Start on Template	118
Length on Template	12
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C386_007

Type	Read
Score	39
Start on Template	111
Length on Template	10
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

C644_002

Type	Read
Score	47
Start on Template	184
Length on Template	25
Start on Read	0
Length of Read	20
Unique	No
Positional Score
Alignment graphic

C856_005

Type	Read
Score	44
Start on Template	202
Length on Template	12
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

C63_007

Type	Read
Score	36
Start on Template	189
Length on Template	7
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C116_009

Type	Read
Score	32
Start on Template	166
Length on Template	10
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C236_005

Type	Read
Score	112
Start on Template	157
Length on Template	16
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1095

Type	Read
Score	190
Start on Template	152
Length on Template	25
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

Combined_968

Type	Read
Score	68
Start on Template	119
Length on Template	11
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_1251

Type	Read
Score	49
Start on Template	53
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C797_005

Type	Read
Score	52
Start on Template	182
Length on Template	27
Start on Read	0
Length of Read	23
Unique	No
Positional Score
Alignment graphic

C1033_003

Type	Read
Score	36
Start on Template	28
Length on Template	10
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

Combined_984

Type	Read
Score	70
Start on Template	44
Length on Template	11
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

Combined_1059

Type	Read
Score	45
Start on Template	177
Length on Template	11
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

Combined_998

Type	Read
Score	54
Start on Template	171
Length on Template	16
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

Combined_2791

Type	Read
Score	41
Start on Template	131
Length on Template	12
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

C1942_003

Type	Read
Score	68
Start on Template	130
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C2921

Type	Read
Score	55
Start on Template	182
Length on Template	27
Start on Read	0
Length of Read	27
Unique	No
Positional Score
Alignment graphic

C8_003

Type	Read
Score	36
Start on Template	58
Length on Template	8
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C395_003

Type	Read
Score	43
Start on Template	152
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_1097

Type	Read
Score	36
Start on Template	201
Length on Template	8
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C1627

Type	Read
Score	41
Start on Template	130
Length on Template	13
Start on Read	0
Length of Read	15
Unique	No
Positional Score
Alignment graphic

Combined_1147

Type	Read
Score	56
Start on Template	53
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

Combined_1149

Type	Read
Score	72
Start on Template	187
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_1090

Type	Read
Score	138
Start on Template	152
Length on Template	21
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C226_006

Type	Read
Score	36
Start on Template	112
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_1159

Type	Read
Score	76
Start on Template	42
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_1162

Type	Read
Score	48
Start on Template	140
Length on Template	6
Start on Read	0
Length of Read	6
Unique	Yes
Positional Score
Alignment graphic

Combined_1098

Type	Read
Score	60
Start on Template	44
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C484_005

Type	Read
Score	118
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_1101

Type	Read
Score	88
Start on Template	101
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C539_005

Type	Read
Score	109
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_2771

Type	Read
Score	97
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C583_002

Type	Read
Score	69
Start on Template	9
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_1249

Type	Read
Score	80
Start on Template	177
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C594_005

Type	Read
Score	41
Start on Template	152
Length on Template	13
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

C679_004

Type	Read
Score	84
Start on Template	44
Length on Template	22
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C778_005

Type	Read
Score	52
Start on Template	183
Length on Template	26
Start on Read	0
Length of Read	26
Unique	No
Positional Score
Alignment graphic

Combined_1258

Type	Read
Score	61
Start on Template	45
Length on Template	10
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

C1365

Type	Read
Score	105
Start on Template	115
Length on Template	15
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1500_003

Type	Read
Score	102
Start on Template	113
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1154

Type	Read
Score	56
Start on Template	105
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

Combined_1156

Type	Read
Score	42
Start on Template	163
Length on Template	11
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

Combined_1161

Type	Read
Score	55
Start on Template	53
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_1237

Type	Read
Score	148
Start on Template	153
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1163

Type	Read
Score	103
Start on Template	198
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_1238

Type	Read
Score	84
Start on Template	41
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C394_003

Type	Read
Score	83
Start on Template	197
Length on Template	14
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_1167

Type	Read
Score	88
Start on Template	42
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_1170

Type	Read
Score	51
Start on Template	139
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

C690

Type	Read
Score	49
Start on Template	61
Length on Template	16
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C779_004

Type	Read
Score	49
Start on Template	53
Length on Template	14
Start on Read	0
Length of Read	14
Unique	No
Positional Score
Alignment graphic

Combined_2934

Type	Read
Score	103
Start on Template	44
Length on Template	18
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_1179

Type	Read
Score	63
Start on Template	112
Length on Template	8
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_1185

Type	Read
Score	42
Start on Template	201
Length on Template	10
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1518_002

Type	Read
Score	50
Start on Template	108
Length on Template	12
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

Combined_1201

Type	Read
Score	80
Start on Template	130
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C2012_004

Type	Read
Score	54
Start on Template	173
Length on Template	14
Start on Read	0
Length of Read	14
Unique	No
Positional Score
Alignment graphic

Combined_1213

Type	Read
Score	126
Start on Template	114
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C2457

Type	Read
Score	55
Start on Template	170
Length on Template	16
Start on Read	0
Length of Read	16
Unique	No
Positional Score
Alignment graphic

C2670_003

Type	Read
Score	44
Start on Template	20
Length on Template	11
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

Combined_1305

Type	Read
Score	56
Start on Template	183
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

C253_008

Type	Read
Score	136
Start on Template	152
Length on Template	21
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C276_004

Type	Read
Score	30
Start on Template	199
Length on Template	8
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C481_005

Type	Read
Score	37
Start on Template	44
Length on Template	9
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C489_007

Type	Read
Score	62
Start on Template	44
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C874_002

Type	Read
Score	73
Start on Template	44
Length on Template	17
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C1188_002

Type	Read
Score	36
Start on Template	112
Length on Template	8
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

Combined_1267

Type	Read
Score	50
Start on Template	111
Length on Template	9
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C1652_003

Type	Read
Score	54
Start on Template	130
Length on Template	18
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C2158_003

Type	Read
Score	117
Start on Template	114
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1782

Type	Read
Score	103
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C2411

Type	Read
Score	75
Start on Template	116
Length on Template	16
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2739_002

Type	Read
Score	74
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C3037_002

Type	Read
Score	44
Start on Template	179
Length on Template	17
Start on Read	0
Length of Read	14
Unique	No
Positional Score
Alignment graphic

Combined_2914

Type	Read
Score	40
Start on Template	159
Length on Template	8
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C253_009

Type	Read
Score	141
Start on Template	152
Length on Template	21
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C387_002

Type	Read
Score	91
Start on Template	198
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C423_007

Type	Read
Score	114
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1322

Type	Read
Score	42
Start on Template	152
Length on Template	10
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

Combined_3594

Type	Read
Score	43
Start on Template	140
Length on Template	6
Start on Read	0
Length of Read	6
Unique	Yes
Positional Score
Alignment graphic

Combined_2832

Type	Read
Score	64
Start on Template	101
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_2041

Type	Read
Score	78
Start on Template	101
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_1334

Type	Read
Score	78
Start on Template	101
Length on Template	11
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_1622

Type	Read
Score	109
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C742_004

Type	Read
Score	106
Start on Template	195
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_2834

Type	Read
Score	41
Start on Template	125
Length on Template	12
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

Combined_1341

Type	Read
Score	120
Start on Template	177
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C981_003

Type	Read
Score	72
Start on Template	44
Length on Template	18
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

Combined_1359

Type	Read
Score	44
Start on Template	177
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1547_002

Type	Read
Score	50
Start on Template	162
Length on Template	20
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

Combined_1368

Type	Read
Score	43
Start on Template	46
Length on Template	8
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

Combined_2854

Type	Read
Score	89
Start on Template	61
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2250

Type	Read
Score	117
Start on Template	115
Length on Template	15
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C2303_002

Type	Read
Score	91
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_3026

Type	Read
Score	70
Start on Template	130
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C2817

Type	Read
Score	116
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_1387

Type	Read
Score	110
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C90_010

Type	Read
Score	37
Start on Template	184
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_2875

Type	Read
Score	30
Start on Template	186
Length on Template	6
Start on Read	0
Length of Read	6
Unique	No
Positional Score
Alignment graphic

C253_010

Type	Read
Score	32
Start on Template	52
Length on Template	8
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C288_004

Type	Read
Score	115
Start on Template	157
Length on Template	16
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C342_008

Type	Read
Score	40
Start on Template	154
Length on Template	13
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

C405_005

Type	Read
Score	84
Start on Template	41
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C450_004

Type	Read
Score	35
Start on Template	96
Length on Template	12
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

Combined_1527

Type	Read
Score	80
Start on Template	120
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C729_006

Type	Read
Score	109
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C996_002

Type	Read
Score	75
Start on Template	44
Length on Template	14
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C1015_005

Type	Read
Score	50
Start on Template	130
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C1028_004

Type	Read
Score	38
Start on Template	128
Length on Template	8
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

Combined_1996

Type	Read
Score	80
Start on Template	101
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1678_002

Type	Read
Score	54
Start on Template	104
Length on Template	16
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_3854

Type	Read
Score	58
Start on Template	171
Length on Template	16
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C2051_002

Type	Read
Score	29
Start on Template	149
Length on Template	9
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

Combined_1511

Type	Read
Score	108
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_3956

Type	Read
Score	109
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C296_009

Type	Read
Score	94
Start on Template	173
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C673_003

Type	Read
Score	53
Start on Template	157
Length on Template	18
Start on Read	0
Length of Read	19
Unique	No
Positional Score
Alignment graphic

C89_008

Type	Read
Score	126
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C741_005

Type	Read
Score	52
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

Combined_3976

Type	Read
Score	125
Start on Template	113
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C663_005

Type	Read
Score	88
Start on Template	113
Length on Template	18
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1438

Type	Read
Score	112
Start on Template	173
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_1449

Type	Read
Score	116
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C789_007

Type	Read
Score	108
Start on Template	114
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1190_007

Type	Read
Score	73
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_2406

Type	Read
Score	124
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C769_002

Type	Read
Score	76
Start on Template	116
Length on Template	14
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C279_007

Type	Read
Score	94
Start on Template	174
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C693_006

Type	Read
Score	106
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C893_006

Type	Read
Score	81
Start on Template	114
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C895_005

Type	Read
Score	76
Start on Template	116
Length on Template	14
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1083_003

Type	Read
Score	110
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C99_006

Type	Read
Score	122
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C168_011

Type	Read
Score	32
Start on Template	134
Length on Template	8
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C210_007

Type	Read
Score	106
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C400_006

Type	Read
Score	94
Start on Template	46
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C717_005

Type	Read
Score	96
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C793_005

Type	Read
Score	97
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C967_004

Type	Read
Score	109
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_1706

Type	Read
Score	88
Start on Template	116
Length on Template	14
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1190_009

Type	Read
Score	106
Start on Template	83
Length on Template	25
Start on Read	0
Length of Read	27
Unique	Yes
Positional Score
Alignment graphic

C1193_003

Type	Read
Score	101
Start on Template	131
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_1519

Type	Read
Score	118
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1464_005

Type	Read
Score	98
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1468_004

Type	Read
Score	105
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1474_003

Type	Read
Score	110
Start on Template	131
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_1718

Type	Read
Score	110
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1576_006

Type	Read
Score	96
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C216_011

Type	Read
Score	109
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C708_005

Type	Read
Score	115
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C876_003

Type	Read
Score	95
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C916_005

Type	Read
Score	112
Start on Template	114
Length on Template	16
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

C936_006

Type	Read
Score	56
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C962_004

Type	Read
Score	116
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C994_005

Type	Read
Score	56
Start on Template	173
Length on Template	14
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C1136_004

Type	Read
Score	118
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1314_005

Type	Read
Score	92
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1422_008

Type	Read
Score	86
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1510_007

Type	Read
Score	96
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C308_011

Type	Read
Score	106
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C331_007

Type	Read
Score	92
Start on Template	44
Length on Template	16
Start on Read	0
Length of Read	16
Unique	No
Positional Score
Alignment graphic

Combined_1776

Type	Read
Score	106
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1548

Type	Read
Score	98
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1202_004

Type	Read
Score	62
Start on Template	173
Length on Template	14
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C1207_004

Type	Read
Score	87
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1338_004

Type	Read
Score	83
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C92_013

Type	Read
Score	38
Start on Template	109
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

C161_010

Type	Read
Score	136
Start on Template	156
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_1568

Type	Read
Score	64
Start on Template	203
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_1571

Type	Read
Score	104
Start on Template	198
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C305_011

Type	Read
Score	95
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C310_008

Type	Read
Score	119
Start on Template	153
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C318_007

Type	Read
Score	108
Start on Template	153
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C353_012

Type	Read
Score	48
Start on Template	1
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_1593

Type	Read
Score	38
Start on Template	204
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

C605_006

Type	Read
Score	84
Start on Template	199
Length on Template	12
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C627_008

Type	Read
Score	118
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C662_008

Type	Read
Score	96
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C681_003

Type	Read
Score	95
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_1605

Type	Read
Score	72
Start on Template	51
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C724_004

Type	Read
Score	90
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C780_005

Type	Read
Score	100
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_1615

Type	Read
Score	39
Start on Template	177
Length on Template	10
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C820_005

Type	Read
Score	38
Start on Template	182
Length on Template	10
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

C881_005

Type	Read
Score	97
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C893_007

Type	Read
Score	54
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C907_004

Type	Read
Score	88
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C913_004

Type	Read
Score	100
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C934_002

Type	Read
Score	55
Start on Template	93
Length on Template	15
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C1016_004

Type	Read
Score	80
Start on Template	44
Length on Template	33
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

Combined_1634

Type	Read
Score	37
Start on Template	204
Length on Template	7
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_1757

Type	Read
Score	96
Start on Template	48
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1107_003

Type	Read
Score	84
Start on Template	48
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1154_004

Type	Read
Score	76
Start on Template	46
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1218_004

Type	Read
Score	108
Start on Template	45
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_1648

Type	Read
Score	33
Start on Template	118
Length on Template	8
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C1264_003

Type	Read
Score	117
Start on Template	45
Length on Template	15
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1332_005

Type	Read
Score	88
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1374_005

Type	Read
Score	115
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1402_004

Type	Read
Score	51
Start on Template	41
Length on Template	17
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

Combined_1663

Type	Read
Score	41
Start on Template	5
Length on Template	19
Start on Read	0
Length of Read	16
Unique	No
Positional Score
Alignment graphic

C1570_005

Type	Read
Score	96
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1666

Type	Read
Score	34
Start on Template	153
Length on Template	9
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C1686_004

Type	Read
Score	108
Start on Template	196
Length on Template	15
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1708_005

Type	Read
Score	106
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1797_006

Type	Read
Score	107
Start on Template	44
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1844_009

Type	Read
Score	99
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1908_006

Type	Read
Score	85
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1916_004

Type	Read
Score	112
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C1930_003

Type	Read
Score	125
Start on Template	113
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_1685

Type	Read
Score	96
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1686

Type	Read
Score	76
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C2073_003

Type	Read
Score	100
Start on Template	196
Length on Template	15
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C2090_003

Type	Read
Score	45
Start on Template	124
Length on Template	16
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C2121_005

Type	Read
Score	116
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_1696

Type	Read
Score	123
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C2164_003

Type	Read
Score	104
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C2170

Type	Read
Score	107
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2171_003

Type	Read
Score	66
Start on Template	77
Length on Template	31
Start on Read	0
Length of Read	29
Unique	No
Positional Score
Alignment graphic

C2183_003

Type	Read
Score	73
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C2228

Type	Read
Score	98
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2271

Type	Read
Score	94
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C2321_002

Type	Read
Score	92
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C2334_002

Type	Read
Score	109
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C2375_003

Type	Read
Score	79
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C2409_002

Type	Read
Score	80
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C2411_002

Type	Read
Score	63
Start on Template	81
Length on Template	27
Start on Read	0
Length of Read	29
Unique	No
Positional Score
Alignment graphic

C2452_002

Type	Read
Score	79
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1713

Type	Read
Score	100
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C2472

Type	Read
Score	65
Start on Template	116
Length on Template	14
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

C2498_003

Type	Read
Score	101
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C2504

Type	Read
Score	104
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C2558

Type	Read
Score	107
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C2571_002

Type	Read
Score	80
Start on Template	131
Length on Template	15
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C2630_002

Type	Read
Score	116
Start on Template	113
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C329_010

Type	Read
Score	99
Start on Template	153
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C354_010

Type	Read
Score	53
Start on Template	1
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_1736

Type	Read
Score	72
Start on Template	178
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C545_006

Type	Read
Score	126
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C547_005

Type	Read
Score	37
Start on Template	179
Length on Template	8
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C619_008

Type	Read
Score	118
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C670_007

Type	Read
Score	88
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C717_006

Type	Read
Score	100
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_1746

Type	Read
Score	50
Start on Template	61
Length on Template	7
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C758_007

Type	Read
Score	106
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C780_006

Type	Read
Score	106
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C781_005

Type	Read
Score	118
Start on Template	195
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C796_005

Type	Read
Score	117
Start on Template	149
Length on Template	24
Start on Read	0
Length of Read	24
Unique	Yes
Positional Score
Alignment graphic

C800_005

Type	Read
Score	109
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C894_005

Type	Read
Score	97
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1753

Type	Read
Score	109
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1030_005

Type	Read
Score	82
Start on Template	44
Length on Template	17
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C1111_003

Type	Read
Score	75
Start on Template	48
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1125_007

Type	Read
Score	71
Start on Template	46
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C1143_006

Type	Read
Score	35
Start on Template	178
Length on Template	9
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

Combined_1760

Type	Read
Score	76
Start on Template	46
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1174_005

Type	Read
Score	36
Start on Template	59
Length on Template	9
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

C1228_003

Type	Read
Score	76
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1266_004

Type	Read
Score	91
Start on Template	47
Length on Template	13
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1275_004

Type	Read
Score	107
Start on Template	45
Length on Template	15
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1291_004

Type	Read
Score	76
Start on Template	171
Length on Template	16
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C1373_005

Type	Read
Score	96
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1521_005

Type	Read
Score	249
Start on Template	153
Length on Template	34
Start on Read	0
Length of Read	34
Unique	Yes
Positional Score
Alignment graphic

C1765_008

Type	Read
Score	44
Start on Template	12
Length on Template	18
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

C1831_005

Type	Read
Score	88
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1780

Type	Read
Score	35
Start on Template	1
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C1928_005

Type	Read
Score	117
Start on Template	114
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1939_006

Type	Read
Score	263
Start on Template	153
Length on Template	34
Start on Read	0
Length of Read	34
Unique	Yes
Positional Score
Alignment graphic

C1971_005

Type	Read
Score	128
Start on Template	109
Length on Template	21
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C2066_007

Type	Read
Score	105
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2146_005

Type	Read
Score	73
Start on Template	83
Length on Template	25
Start on Read	0
Length of Read	28
Unique	No
Positional Score
Alignment graphic

C2170_002

Type	Read
Score	114
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_1792

Type	Read
Score	104
Start on Template	133
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C2335_005

Type	Read
Score	92
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C2354_005

Type	Read
Score	71
Start on Template	83
Length on Template	25
Start on Read	0
Length of Read	28
Unique	No
Positional Score
Alignment graphic

Combined_1795

Type	Read
Score	81
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C2390_003

Type	Read
Score	101
Start on Template	131
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C2408_003

Type	Read
Score	82
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C2431

Type	Read
Score	87
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2469_002

Type	Read
Score	107
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C2486_004

Type	Read
Score	107
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C2549_003

Type	Read
Score	106
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C2574

Type	Read
Score	105
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C9_007

Type	Read
Score	56
Start on Template	211
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

C162_007

Type	Read
Score	38
Start on Template	62
Length on Template	5
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C187_009

Type	Read
Score	37
Start on Template	5
Length on Template	5
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C226_009

Type	Read
Score	56
Start on Template	180
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

C317_006

Type	Read
Score	103
Start on Template	153
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C388_006

Type	Read
Score	109
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C461_003

Type	Read
Score	114
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C510_004

Type	Read
Score	100
Start on Template	195
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C549_008

Type	Read
Score	118
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C612_006

Type	Read
Score	100
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C622_008

Type	Read
Score	106
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C641_008

Type	Read
Score	109
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C667_005

Type	Read
Score	97
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C718_006

Type	Read
Score	88
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C728_005

Type	Read
Score	100
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C790_006

Type	Read
Score	109
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C829_009

Type	Read
Score	62
Start on Template	1
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C867_004

Type	Read
Score	45
Start on Template	92
Length on Template	16
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

C893_009

Type	Read
Score	106
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C896_004

Type	Read
Score	106
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C905_004

Type	Read
Score	106
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C922_008

Type	Read
Score	106
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1108_004

Type	Read
Score	190
Start on Template	162
Length on Template	25
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C1288_006

Type	Read
Score	114
Start on Template	45
Length on Template	15
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1393_005

Type	Read
Score	105
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1414_004

Type	Read
Score	39
Start on Template	1
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C1420_007

Type	Read
Score	118
Start on Template	44
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1425_005

Type	Read
Score	58
Start on Template	49
Length on Template	9
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1547_004

Type	Read
Score	34
Start on Template	118
Length on Template	11
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

C1664_005

Type	Read
Score	113
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1854_004

Type	Read
Score	106
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1872_009

Type	Read
Score	50
Start on Template	43
Length on Template	17
Start on Read	0
Length of Read	16
Unique	No
Positional Score
Alignment graphic

Combined_1783

Type	Read
Score	123
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1936_005

Type	Read
Score	80
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1986_003

Type	Read
Score	94
Start on Template	112
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2014_005

Type	Read
Score	99
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C2169

Type	Read
Score	100
Start on Template	198
Length on Template	13
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C2175_002

Type	Read
Score	93
Start on Template	113
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2179_004

Type	Read
Score	106
Start on Template	83
Length on Template	25
Start on Read	0
Length of Read	27
Unique	Yes
Positional Score
Alignment graphic

C2379_003

Type	Read
Score	97
Start on Template	83
Length on Template	25
Start on Read	0
Length of Read	27
Unique	Yes
Positional Score
Alignment graphic

C2422_003

Type	Read
Score	92
Start on Template	131
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C2434_003

Type	Read
Score	90
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C2479

Type	Read
Score	88
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C2518

Type	Read
Score	98
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C2588_003

Type	Read
Score	92
Start on Template	131
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C2635

Type	Read
Score	120
Start on Template	113
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C801_008

Type	Read
Score	43
Start on Template	93
Length on Template	11
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

Combined_1831

Type	Read
Score	29
Start on Template	97
Length on Template	7
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C1615_006

Type	Read
Score	32
Start on Template	147
Length on Template	11
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C2193_004

Type	Read
Score	34
Start on Template	178
Length on Template	11
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

Combined_1877

Type	Read
Score	40
Start on Template	92
Length on Template	13
Start on Read	0
Length of Read	14
Unique	No
Positional Score
Alignment graphic

Combined_2920

Type	Read
Score	36
Start on Template	46
Length on Template	11
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

Combined_1861

Type	Read
Score	29
Start on Template	28
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C1135_005

Type	Read
Score	32
Start on Template	147
Length on Template	11
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C1487_005

Type	Read
Score	40
Start on Template	182
Length on Template	14
Start on Read	0
Length of Read	16
Unique	No
Positional Score
Alignment graphic

Combined_3259

Type	Read
Score	54
Start on Template	196
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C439_007

Type	Read
Score	182
Start on Template	152
Length on Template	25
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C446_008

Type	Read
Score	34
Start on Template	62
Length on Template	11
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

Combined_2043

Type	Read
Score	38
Start on Template	172
Length on Template	11
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

C602_009

Type	Read
Score	44
Start on Template	5
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

C685_009

Type	Read
Score	40
Start on Template	19
Length on Template	14
Start on Read	0
Length of Read	14
Unique	No
Positional Score
Alignment graphic

Combined_1985

Type	Read
Score	104
Start on Template	183
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_1927

Type	Read
Score	88
Start on Template	185
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C95_006

Type	Read
Score	77
Start on Template	205
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_2580

Type	Read
Score	64
Start on Template	42
Length on Template	11
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

Combined_2590

Type	Read
Score	35
Start on Template	201
Length on Template	8
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

Combined_1903

Type	Read
Score	56
Start on Template	5
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

Combined_1932

Type	Read
Score	52
Start on Template	111
Length on Template	9
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_2596

Type	Read
Score	38
Start on Template	128
Length on Template	8
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

Combined_1906

Type	Read
Score	43
Start on Template	201
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C686_013

Type	Read
Score	101
Start on Template	105
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_1972

Type	Read
Score	86
Start on Template	1
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C138_010

Type	Read
Score	75
Start on Template	41
Length on Template	13
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C149_011

Type	Read
Score	35
Start on Template	184
Length on Template	10
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

Combined_1994

Type	Read
Score	70
Start on Template	1
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_1997

Type	Read
Score	29
Start on Template	146
Length on Template	5
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C545_007

Type	Read
Score	98
Start on Template	105
Length on Template	15
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C549_009

Type	Read
Score	70
Start on Template	101
Length on Template	10
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C990_006

Type	Read
Score	51
Start on Template	112
Length on Template	8
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C1266_005

Type	Read
Score	54
Start on Template	1
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1630_006

Type	Read
Score	51
Start on Template	175
Length on Template	11
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

Combined_2032

Type	Read
Score	104
Start on Template	205
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C599_005

Type	Read
Score	56
Start on Template	139
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C617_005

Type	Read
Score	97
Start on Template	103
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C105_009

Type	Read
Score	69
Start on Template	183
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C107_011

Type	Read
Score	68
Start on Template	205
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_2033

Type	Read
Score	82
Start on Template	184
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C188_009

Type	Read
Score	50
Start on Template	183
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C210_009

Type	Read
Score	136
Start on Template	153
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_1953

Type	Read
Score	71
Start on Template	139
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C274_010

Type	Read
Score	54
Start on Template	118
Length on Template	13
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

C312_012

Type	Read
Score	155
Start on Template	152
Length on Template	25
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C385_011

Type	Read
Score	100
Start on Template	154
Length on Template	22
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C574_005

Type	Read
Score	36
Start on Template	149
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_2052

Type	Read
Score	94
Start on Template	42
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C814_007

Type	Read
Score	80
Start on Template	105
Length on Template	15
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C820_009

Type	Read
Score	76
Start on Template	105
Length on Template	15
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C958_009

Type	Read
Score	41
Start on Template	170
Length on Template	15
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C1284_003

Type	Read
Score	83
Start on Template	60
Length on Template	20
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1286_005

Type	Read
Score	52
Start on Template	130
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1340_006

Type	Read
Score	94
Start on Template	1
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C106_006

Type	Read
Score	92
Start on Template	183
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C166_012

Type	Read
Score	77
Start on Template	183
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_3273

Type	Read
Score	43
Start on Template	53
Length on Template	9
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_1991

Type	Read
Score	29
Start on Template	146
Length on Template	5
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C526_005

Type	Read
Score	118
Start on Template	120
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_2051

Type	Read
Score	68
Start on Template	139
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_2053

Type	Read
Score	89
Start on Template	105
Length on Template	15
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C809_008

Type	Read
Score	62
Start on Template	3
Length on Template	9
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1044_008

Type	Read
Score	45
Start on Template	130
Length on Template	13
Start on Read	0
Length of Read	15
Unique	No
Positional Score
Alignment graphic

C360_009

Type	Read
Score	176
Start on Template	196
Length on Template	22
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C432_008

Type	Read
Score	55
Start on Template	61
Length on Template	12
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C473_004

Type	Read
Score	52
Start on Template	138
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C906_002

Type	Read
Score	41
Start on Template	201
Length on Template	10
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_2670

Type	Read
Score	47
Start on Template	174
Length on Template	12
Start on Read	0
Length of Read	15
Unique	No
Positional Score
Alignment graphic

Combined_2109

Type	Read
Score	29
Start on Template	76
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C723_007

Type	Read
Score	55
Start on Template	21
Length on Template	28
Start on Read	0
Length of Read	28
Unique	No
Positional Score
Alignment graphic

Combined_2140

Type	Read
Score	44
Start on Template	48
Length on Template	15
Start on Read	0
Length of Read	16
Unique	No
Positional Score
Alignment graphic

Combined_2145

Type	Read
Score	120
Start on Template	173
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_2149

Type	Read
Score	34
Start on Template	135
Length on Template	9
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

Combined_2216

Type	Read
Score	44
Start on Template	45
Length on Template	9
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

Combined_2185

Type	Read
Score	35
Start on Template	135
Length on Template	8
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C1157_007

Type	Read
Score	34
Start on Template	27
Length on Template	9
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C824_013

Type	Read
Score	117
Start on Template	171
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_2247

Type	Read
Score	37
Start on Template	133
Length on Template	8
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C1599_006

Type	Read
Score	107
Start on Template	130
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_3319

Type	Read
Score	37
Start on Template	68
Length on Template	12
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

C790_008

Type	Read
Score	134
Start on Template	171
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C780_011

Type	Read
Score	115
Start on Template	171
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C253_015

Type	Read
Score	118
Start on Template	154
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C896_006

Type	Read
Score	88
Start on Template	170
Length on Template	18
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C992_006

Type	Read
Score	122
Start on Template	173
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1246_007

Type	Read
Score	106
Start on Template	130
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1512_006

Type	Read
Score	125
Start on Template	130
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_2766

Type	Read
Score	139
Start on Template	153
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C277_009

Type	Read
Score	107
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C884_007

Type	Read
Score	105
Start on Template	171
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_2347

Type	Read
Score	140
Start on Template	173
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1223_004

Type	Read
Score	113
Start on Template	130
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1241_008

Type	Read
Score	109
Start on Template	130
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1564_009

Type	Read
Score	99
Start on Template	115
Length on Template	15
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

C313_008

Type	Read
Score	104
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C748_006

Type	Read
Score	73
Start on Template	44
Length on Template	15
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

Combined_2421

Type	Read
Score	115
Start on Template	171
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_2381

Type	Read
Score	126
Start on Template	171
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C984_006

Type	Read
Score	48
Start on Template	114
Length on Template	14
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1403_003

Type	Read
Score	47
Start on Template	127
Length on Template	16
Start on Read	0
Length of Read	16
Unique	No
Positional Score
Alignment graphic

C137_008

Type	Read
Score	35
Start on Template	155
Length on Template	9
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C141_015

Type	Read
Score	30
Start on Template	68
Length on Template	6
Start on Read	0
Length of Read	6
Unique	No
Positional Score
Alignment graphic

C305_015

Type	Read
Score	116
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C344_010

Type	Read
Score	80
Start on Template	153
Length on Template	17
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_2402

Type	Read
Score	29
Start on Template	19
Length on Template	14
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C444_014

Type	Read
Score	124
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C868_008

Type	Read
Score	118
Start on Template	171
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1029_007

Type	Read
Score	131
Start on Template	174
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1048_007

Type	Read
Score	126
Start on Template	173
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_2390

Type	Read
Score	125
Start on Template	130
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_2459

Type	Read
Score	111
Start on Template	130
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1593_005

Type	Read
Score	92
Start on Template	130
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1600_008

Type	Read
Score	120
Start on Template	130
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1624_006

Type	Read
Score	29
Start on Template	46
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

Combined_2436

Type	Read
Score	126
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1981_008

Type	Read
Score	105
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1994_006

Type	Read
Score	89
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C335_015

Type	Read
Score	104
Start on Template	153
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C778_013

Type	Read
Score	34
Start on Template	139
Length on Template	12
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

Combined_2449

Type	Read
Score	136
Start on Template	170
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C906_006

Type	Read
Score	115
Start on Template	170
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C927_008

Type	Read
Score	167
Start on Template	170
Length on Template	22
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

C929_006

Type	Read
Score	148
Start on Template	171
Length on Template	21
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C984_007

Type	Read
Score	88
Start on Template	171
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_2452

Type	Read
Score	112
Start on Template	173
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1427_007

Type	Read
Score	64
Start on Template	99
Length on Template	13
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C1834_007

Type	Read
Score	98
Start on Template	131
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1900_006

Type	Read
Score	79
Start on Template	116
Length on Template	14
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

Combined_2454

Type	Read
Score	143
Start on Template	130
Length on Template	19
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C2092_004

Type	Read
Score	98
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C127_009

Type	Read
Score	40
Start on Template	17
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C243_009

Type	Read
Score	83
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C389_013

Type	Read
Score	124
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C841_007

Type	Read
Score	109
Start on Template	171
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C866_005

Type	Read
Score	176
Start on Template	170
Length on Template	22
Start on Read	0
Length of Read	22
Unique	Yes
Positional Score
Alignment graphic

Combined_3742

Type	Read
Score	36
Start on Template	94
Length on Template	13
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C1289_007

Type	Read
Score	96
Start on Template	118
Length on Template	12
Start on Read	0
Length of Read	12
Unique	Yes
Positional Score
Alignment graphic

C1310_004

Type	Read
Score	90
Start on Template	130
Length on Template	22
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C1336_011

Type	Read
Score	82
Start on Template	99
Length on Template	13
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C1622_006

Type	Read
Score	74
Start on Template	130
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_3942

Type	Read
Score	79
Start on Template	116
Length on Template	14
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1809_005

Type	Read
Score	88
Start on Template	113
Length on Template	18
Start on Read	0
Length of Read	20
Unique	No
Positional Score
Alignment graphic

C2014_008

Type	Read
Score	86
Start on Template	130
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C667_009

Type	Read
Score	39
Start on Template	21
Length on Template	15
Start on Read	0
Length of Read	15
Unique	No
Positional Score
Alignment graphic

Combined_2517

Type	Read
Score	36
Start on Template	93
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

Combined_2564

Type	Read
Score	53
Start on Template	171
Length on Template	15
Start on Read	0
Length of Read	16
Unique	No
Positional Score
Alignment graphic

Combined_2521

Type	Read
Score	29
Start on Template	110
Length on Template	9
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C92_018

Type	Read
Score	33
Start on Template	46
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

Combined_3877

Type	Read
Score	40
Start on Template	154
Length on Template	12
Start on Read	0
Length of Read	14
Unique	No
Positional Score
Alignment graphic

C546_016

Type	Read
Score	61
Start on Template	183
Length on Template	26
Start on Read	0
Length of Read	28
Unique	No
Positional Score
Alignment graphic

C571_012

Type	Read
Score	40
Start on Template	128
Length on Template	8
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C1052_011

Type	Read
Score	44
Start on Template	126
Length on Template	17
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

Combined_2663

Type	Read
Score	63
Start on Template	170
Length on Template	17
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C89_015

Type	Read
Score	29
Start on Template	101
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C209_010

Type	Read
Score	106
Start on Template	196
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

Combined_2588

Type	Read
Score	56
Start on Template	139
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

Combined_2648

Type	Read
Score	42
Start on Template	180
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

Combined_2647

Type	Read
Score	49
Start on Template	53
Length on Template	14
Start on Read	0
Length of Read	14
Unique	No
Positional Score
Alignment graphic

C1175_006

Type	Read
Score	55
Start on Template	171
Length on Template	16
Start on Read	0
Length of Read	16
Unique	No
Positional Score
Alignment graphic

C2034_009

Type	Read
Score	46
Start on Template	128
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C153_010

Type	Read
Score	33
Start on Template	128
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

Combined_2712

Type	Read
Score	29
Start on Template	178
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

Combined_2777

Type	Read
Score	54
Start on Template	113
Length on Template	7
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C1303_005

Type	Read
Score	63
Start on Template	171
Length on Template	16
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

Combined_2899

Type	Read
Score	59
Start on Template	171
Length on Template	16
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C1578_012

Type	Read
Score	55
Start on Template	175
Length on Template	12
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C606_010

Type	Read
Score	47
Start on Template	167
Length on Template	20
Start on Read	0
Length of Read	21
Unique	No
Positional Score
Alignment graphic

C750_013

Type	Read
Score	49
Start on Template	187
Length on Template	22
Start on Read	0
Length of Read	23
Unique	No
Positional Score
Alignment graphic

C891_010

Type	Read
Score	49
Start on Template	162
Length on Template	21
Start on Read	0
Length of Read	22
Unique	No
Positional Score
Alignment graphic

C311_011

Type	Read
Score	97
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C424_009

Type	Read
Score	44
Start on Template	113
Length on Template	7
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

Combined_2837

Type	Read
Score	72
Start on Template	130
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C959_009

Type	Read
Score	41
Start on Template	26
Length on Template	10
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C1816_009

Type	Read
Score	103
Start on Template	114
Length on Template	16
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

C106_011

Type	Read
Score	76
Start on Template	200
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C191_014

Type	Read
Score	30
Start on Template	46
Length on Template	7
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C275_016

Type	Read
Score	151
Start on Template	153
Length on Template	20
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

Combined_2879

Type	Read
Score	53
Start on Template	2
Length on Template	8
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C439_012

Type	Read
Score	39
Start on Template	61
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

Combined_2928

Type	Read
Score	78
Start on Template	42
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_2881

Type	Read
Score	64
Start on Template	103
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C559_014

Type	Read
Score	109
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_2991

Type	Read
Score	73
Start on Template	47
Length on Template	13
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_3810

Type	Read
Score	49
Start on Template	53
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C872_012

Type	Read
Score	135
Start on Template	149
Length on Template	28
Start on Read	0
Length of Read	27
Unique	Yes
Positional Score
Alignment graphic

Combined_3008

Type	Read
Score	72
Start on Template	137
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C1430_010

Type	Read
Score	52
Start on Template	105
Length on Template	15
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

C1483_004

Type	Read
Score	49
Start on Template	14
Length on Template	23
Start on Read	0
Length of Read	22
Unique	No
Positional Score
Alignment graphic

C2076_005

Type	Read
Score	115
Start on Template	112
Length on Template	18
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_3959

Type	Read
Score	38
Start on Template	182
Length on Template	13
Start on Read	0
Length of Read	14
Unique	No
Positional Score
Alignment graphic

Combined_2916

Type	Read
Score	72
Start on Template	183
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C157_020

Type	Read
Score	77
Start on Template	183
Length on Template	13
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_3207

Type	Read
Score	47
Start on Template	61
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

Combined_2930

Type	Read
Score	110
Start on Template	195
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

Combined_2931

Type	Read
Score	106
Start on Template	43
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

Combined_3543

Type	Read
Score	60
Start on Template	130
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C1217_007

Type	Read
Score	49
Start on Template	171
Length on Template	16
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C2211_003

Type	Read
Score	108
Start on Template	114
Length on Template	16
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C181_021

Type	Read
Score	129
Start on Template	152
Length on Template	21
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C249_021

Type	Read
Score	108
Start on Template	196
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C341_015

Type	Read
Score	104
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C510_009

Type	Read
Score	29
Start on Template	204
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C635_015

Type	Read
Score	106
Start on Template	196
Length on Template	15
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_2996

Type	Read
Score	59
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_2997

Type	Read
Score	64
Start on Template	138
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C1184_012

Type	Read
Score	60
Start on Template	43
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C1616_009

Type	Read
Score	72
Start on Template	46
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C1839_010

Type	Read
Score	38
Start on Template	144
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

C84_020

Type	Read
Score	63
Start on Template	187
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C206_015

Type	Read
Score	141
Start on Template	152
Length on Template	21
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C327_013

Type	Read
Score	103
Start on Template	197
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C570_008

Type	Read
Score	118
Start on Template	195
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C675_006

Type	Read
Score	75
Start on Template	196
Length on Template	15
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C923_012

Type	Read
Score	112
Start on Template	41
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

Combined_3075

Type	Read
Score	56
Start on Template	45
Length on Template	10
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

C1330_008

Type	Read
Score	94
Start on Template	93
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

Combined_3511

Type	Read
Score	27
Start on Template	208
Length on Template	5
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C2506_003

Type	Read
Score	37
Start on Template	154
Length on Template	11
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C28_013

Type	Read
Score	37
Start on Template	184
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_3619

Type	Read
Score	72
Start on Template	103
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C213_014

Type	Read
Score	126
Start on Template	152
Length on Template	21
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

C477_018

Type	Read
Score	145
Start on Template	153
Length on Template	24
Start on Read	0
Length of Read	23
Unique	Yes
Positional Score
Alignment graphic

C517_017

Type	Read
Score	46
Start on Template	103
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C573_013

Type	Read
Score	40
Start on Template	52
Length on Template	14
Start on Read	0
Length of Read	14
Unique	No
Positional Score
Alignment graphic

C682_013

Type	Read
Score	79
Start on Template	43
Length on Template	17
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C839_009

Type	Read
Score	116
Start on Template	44
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1273_012

Type	Read
Score	79
Start on Template	93
Length on Template	19
Start on Read	0
Length of Read	21
Unique	No
Positional Score
Alignment graphic

C1589_010

Type	Read
Score	54
Start on Template	46
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C15_009

Type	Read
Score	61
Start on Template	204
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C638_005

Type	Read
Score	44
Start on Template	48
Length on Template	19
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

Combined_3124

Type	Read
Score	35
Start on Template	1
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C150_019

Type	Read
Score	75
Start on Template	46
Length on Template	15
Start on Read	0
Length of Read	15
Unique	No
Positional Score
Alignment graphic

C67_026

Type	Read
Score	35
Start on Template	1
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C161_022

Type	Read
Score	95
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C212_025

Type	Read
Score	92
Start on Template	46
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C185_016

Type	Read
Score	88
Start on Template	46
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C183_018

Type	Read
Score	41
Start on Template	107
Length on Template	13
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C387_013

Type	Read
Score	36
Start on Template	95
Length on Template	9
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1079_012

Type	Read
Score	52
Start on Template	171
Length on Template	15
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C890_014

Type	Read
Score	43
Start on Template	173
Length on Template	13
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C1837_008

Type	Read
Score	46
Start on Template	95
Length on Template	16
Start on Read	0
Length of Read	15
Unique	No
Positional Score
Alignment graphic

C2198_005

Type	Read
Score	41
Start on Template	177
Length on Template	11
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C794_012

Type	Read
Score	51
Start on Template	20
Length on Template	17
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C2161_005

Type	Read
Score	40
Start on Template	191
Length on Template	14
Start on Read	0
Length of Read	14
Unique	No
Positional Score
Alignment graphic

C664_016

Type	Read
Score	35
Start on Template	1
Length on Template	9
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C672_009

Type	Read
Score	55
Start on Template	166
Length on Template	22
Start on Read	0
Length of Read	24
Unique	No
Positional Score
Alignment graphic

C1847_008

Type	Read
Score	39
Start on Template	133
Length on Template	14
Start on Read	0
Length of Read	14
Unique	No
Positional Score
Alignment graphic

C1961_010

Type	Read
Score	38
Start on Template	108
Length on Template	13
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C936_014

Type	Read
Score	51
Start on Template	1
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C66_025

Type	Read
Score	29
Start on Template	149
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C529_018

Type	Read
Score	48
Start on Template	111
Length on Template	9
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C238_025

Type	Read
Score	35
Start on Template	96
Length on Template	9
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

Combined_3308

Type	Read
Score	42
Start on Template	180
Length on Template	11
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C1082_008

Type	Read
Score	35
Start on Template	33
Length on Template	9
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C40_014

Type	Read
Score	43
Start on Template	127
Length on Template	11
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

Combined_3442

Type	Read
Score	45
Start on Template	55
Length on Template	16
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

Combined_3412

Type	Read
Score	36
Start on Template	17
Length on Template	19
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

Combined_3429

Type	Read
Score	41
Start on Template	133
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C322_024

Type	Read
Score	37
Start on Template	16
Length on Template	8
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C751_016

Type	Read
Score	36
Start on Template	99
Length on Template	12
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

C531_015

Type	Read
Score	40
Start on Template	17
Length on Template	13
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

C92_025

Type	Read
Score	43
Start on Template	17
Length on Template	10
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C1626_011

Type	Read
Score	49
Start on Template	133
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C129_020

Type	Read
Score	38
Start on Template	17
Length on Template	11
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

C1690_006

Type	Read
Score	37
Start on Template	77
Length on Template	8
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C614_019

Type	Read
Score	39
Start on Template	153
Length on Template	12
Start on Read	0
Length of Read	15
Unique	No
Positional Score
Alignment graphic

Combined_3489

Type	Read
Score	32
Start on Template	27
Length on Template	8
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C2741_005

Type	Read
Score	46
Start on Template	77
Length on Template	14
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

C994_014

Type	Read
Score	30
Start on Template	97
Length on Template	9
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C3707

Type	Read
Score	39
Start on Template	134
Length on Template	10
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C1183_010

Type	Read
Score	36
Start on Template	129
Length on Template	8
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C1015_016

Type	Read
Score	68
Start on Template	101
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_3595

Type	Read
Score	54
Start on Template	60
Length on Template	8
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C557_013

Type	Read
Score	38
Start on Template	105
Length on Template	7
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

Combined_3560

Type	Read
Score	46
Start on Template	5
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_3561

Type	Read
Score	29
Start on Template	146
Length on Template	5
Start on Read	0
Length of Read	7
Unique	No
Positional Score
Alignment graphic

C1962_013

Type	Read
Score	36
Start on Template	147
Length on Template	11
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_3571

Type	Read
Score	55
Start on Template	139
Length on Template	7
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_3570

Type	Read
Score	68
Start on Template	101
Length on Template	11
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C822_012

Type	Read
Score	44
Start on Template	5
Length on Template	7
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C115_021

Type	Read
Score	92
Start on Template	205
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C418_016

Type	Read
Score	51
Start on Template	41
Length on Template	12
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C577_013

Type	Read
Score	64
Start on Template	122
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C606_016

Type	Read
Score	48
Start on Template	130
Length on Template	15
Start on Read	0
Length of Read	15
Unique	No
Positional Score
Alignment graphic

C627_012

Type	Read
Score	66
Start on Template	101
Length on Template	11
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C772_014

Type	Read
Score	79
Start on Template	120
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_3575

Type	Read
Score	60
Start on Template	111
Length on Template	9
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C836_015

Type	Read
Score	37
Start on Template	5
Length on Template	8
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

Combined_3577

Type	Read
Score	40
Start on Template	69
Length on Template	9
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1054_012

Type	Read
Score	35
Start on Template	111
Length on Template	9
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C1095_012

Type	Read
Score	50
Start on Template	130
Length on Template	42
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

C1242_008

Type	Read
Score	35
Start on Template	130
Length on Template	10
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C1296_012

Type	Read
Score	59
Start on Template	111
Length on Template	9
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

Combined_3582

Type	Read
Score	79
Start on Template	120
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C1331_007

Type	Read
Score	55
Start on Template	105
Length on Template	15
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_3605

Type	Read
Score	68
Start on Template	101
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

Combined_3642

Type	Read
Score	62
Start on Template	132
Length on Template	8
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_3620

Type	Read
Score	63
Start on Template	140
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C281_015

Type	Read
Score	65
Start on Template	205
Length on Template	13
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C760_020

Type	Read
Score	46
Start on Template	5
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C780_014

Type	Read
Score	34
Start on Template	144
Length on Template	8
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

C785_019

Type	Read
Score	52
Start on Template	111
Length on Template	9
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_3625

Type	Read
Score	61
Start on Template	196
Length on Template	9
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C1148_012

Type	Read
Score	55
Start on Template	130
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C1165_013

Type	Read
Score	59
Start on Template	130
Length on Template	42
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C1377_013

Type	Read
Score	68
Start on Template	111
Length on Template	9
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C1498_012

Type	Read
Score	79
Start on Template	101
Length on Template	10
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C1546_007

Type	Read
Score	74
Start on Template	106
Length on Template	14
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C1552_009

Type	Read
Score	76
Start on Template	44
Length on Template	11
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

Combined_3636

Type	Read
Score	60
Start on Template	119
Length on Template	10
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C1791_008

Type	Read
Score	46
Start on Template	139
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

C317_015

Type	Read
Score	60
Start on Template	196
Length on Template	9
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C325_018

Type	Read
Score	46
Start on Template	199
Length on Template	6
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C354_023

Type	Read
Score	55
Start on Template	198
Length on Template	7
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C489_021

Type	Read
Score	36
Start on Template	140
Length on Template	6
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

C625_019

Type	Read
Score	48
Start on Template	58
Length on Template	9
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C854_011

Type	Read
Score	51
Start on Template	139
Length on Template	7
Start on Read	0
Length of Read	7
Unique	Yes
Positional Score
Alignment graphic

C978_012

Type	Read
Score	52
Start on Template	111
Length on Template	9
Start on Read	0
Length of Read	11
Unique	No
Positional Score
Alignment graphic

C1047_012

Type	Read
Score	61
Start on Template	196
Length on Template	9
Start on Read	0
Length of Read	11
Unique	Yes
Positional Score
Alignment graphic

C1071_012

Type	Read
Score	52
Start on Template	45
Length on Template	8
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

C1509_004

Type	Read
Score	71
Start on Template	120
Length on Template	9
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

C1769_010

Type	Read
Score	55
Start on Template	198
Length on Template	7
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C1865_011

Type	Read
Score	46
Start on Template	111
Length on Template	9
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

C1923_012

Type	Read
Score	53
Start on Template	130
Length on Template	10
Start on Read	0
Length of Read	10
Unique	Yes
Positional Score
Alignment graphic

Combined_3664

Type	Read
Score	116
Start on Template	44
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C4_007

Type	Read
Score	50
Start on Template	1
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C233_026

Type	Read
Score	80
Start on Template	46
Length on Template	14
Start on Read	0
Length of Read	14
Unique	Yes
Positional Score
Alignment graphic

C935_017

Type	Read
Score	117
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

Combined_3967

Type	Read
Score	128
Start on Template	44
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C343_018

Type	Read
Score	46
Start on Template	155
Length on Template	18
Start on Read	0
Length of Read	19
Unique	No
Positional Score
Alignment graphic

C816_014

Type	Read
Score	36
Start on Template	135
Length on Template	7
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C190_030

Type	Read
Score	45
Start on Template	69
Length on Template	13
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

Combined_3729

Type	Read
Score	45
Start on Template	42
Length on Template	16
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

Combined_3769

Type	Read
Score	44
Start on Template	17
Length on Template	16
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C871_015

Type	Read
Score	37
Start on Template	73
Length on Template	11
Start on Read	0
Length of Read	12
Unique	No
Positional Score
Alignment graphic

C111_026

Type	Read
Score	35
Start on Template	174
Length on Template	9
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C86_023

Type	Read
Score	37
Start on Template	184
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

Combined_3915

Type	Read
Score	52
Start on Template	130
Length on Template	15
Start on Read	0
Length of Read	15
Unique	Yes
Positional Score
Alignment graphic

C1484_014

Type	Read
Score	38
Start on Template	13
Length on Template	17
Start on Read	0
Length of Read	13
Unique	No
Positional Score
Alignment graphic

Combined_3878

Type	Read
Score	88
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C315_028

Type	Read
Score	65
Start on Template	187
Length on Template	23
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C1169_011

Type	Read
Score	63
Start on Template	170
Length on Template	16
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

C88_024

Type	Read
Score	37
Start on Template	56
Length on Template	8
Start on Read	0
Length of Read	8
Unique	No
Positional Score
Alignment graphic

Combined_3929

Type	Read
Score	54
Start on Template	196
Length on Template	9
Start on Read	0
Length of Read	9
Unique	Yes
Positional Score
Alignment graphic

C153_021

Type	Read
Score	43
Start on Template	53
Length on Template	8
Start on Read	0
Length of Read	8
Unique	Yes
Positional Score
Alignment graphic

C460_018

Type	Read
Score	92
Start on Template	44
Length on Template	16
Start on Read	0
Length of Read	16
Unique	No
Positional Score
Alignment graphic

C876_019

Type	Read
Score	53
Start on Template	106
Length on Template	14
Start on Read	0
Length of Read	13
Unique	Yes
Positional Score
Alignment graphic

C1482_014

Type	Read
Score	117
Start on Template	114
Length on Template	16
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

C59_027

Type	Read
Score	133
Start on Template	152
Length on Template	25
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

Combined_3955

Type	Read
Score	108
Start on Template	114
Length on Template	16
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

C34_016

Type	Read
Score	36
Start on Template	178
Length on Template	9
Start on Read	0
Length of Read	9
Unique	No
Positional Score
Alignment graphic

C190_033

Type	Read
Score	35
Start on Template	27
Length on Template	9
Start on Read	0
Length of Read	10
Unique	No
Positional Score
Alignment graphic

C229_023

Type	Read
Score	104
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	20
Unique	Yes
Positional Score
Alignment graphic

C241_019

Type	Read
Score	154
Start on Template	152
Length on Template	25
Start on Read	0
Length of Read	25
Unique	Yes
Positional Score
Alignment graphic

C618_022

Type	Read
Score	178
Start on Template	149
Length on Template	28
Start on Read	0
Length of Read	28
Unique	Yes
Positional Score
Alignment graphic

C889_019

Type	Read
Score	117
Start on Template	45
Length on Template	15
Start on Read	0
Length of Read	18
Unique	Yes
Positional Score
Alignment graphic

C1108_013

Type	Read
Score	46
Start on Template	171
Length on Template	18
Start on Read	0
Length of Read	17
Unique	No
Positional Score
Alignment graphic

C1469_006

Type	Read
Score	111
Start on Template	130
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C370_020

Type	Read
Score	108
Start on Template	194
Length on Template	17
Start on Read	0
Length of Read	17
Unique	Yes
Positional Score
Alignment graphic

C418_019

Type	Read
Score	45
Start on Template	159
Length on Template	17
Start on Read	0
Length of Read	18
Unique	No
Positional Score
Alignment graphic

C560_022

Type	Read
Score	110
Start on Template	44
Length on Template	16
Start on Read	0
Length of Read	16
Unique	Yes
Positional Score
Alignment graphic

C851_018

Type	Read
Score	115
Start on Template	45
Length on Template	15
Start on Read	0
Length of Read	19
Unique	Yes
Positional Score
Alignment graphic

C200_030

Type	Read
Score	103
Start on Template	192
Length on Template	19
Start on Read	0
Length of Read	21
Unique	Yes
Positional Score
Alignment graphic

>REC-0-1_002 template
.DNLVMTQTPKFLLVTPGEPATITLRSSQSLLNENGYNYKYWYQKKPGQSPQLLIYQASTRASGVPDRFGSPRYGTGGSDFISRVQAEDLAVPECHQDLQSPTFGAGTKLEIKTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPRLAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFGRNEC
>C1095_012 score:50 alignment:7M24D11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV...................................SSTM.EV.THQGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1165_013 score:59 alignment:7M23D12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..................................GGSGM.EV.THQGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C224_002 score:272 alignment:34M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDNALQS.GNSQE.SV.TEQDSK.DSTY.SL..SS..T.LT.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1939_006 score:263 alignment:34M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VNNALQS.GNSQE.SV.TEQDSK.DSTY.SL..SS..T.LT.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1521_005 score:249 alignment:34M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDNALQS.GNSEE.GK.TEQDSK.DSTY.SL..SS..T.LT.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1016_004 score:80 alignment:10M14D2M2D5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..L...................GS..YGVDK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2171_003 score:66 alignment:10M2D19M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAVQSNLNAT..GHLECH.DYSSP..L.TFGAGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C872_012 score:135 alignment:7M1D2M1D5M1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VQWKQEQ.LQ..GDSQVQSV.TEQDSK.DSTY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C618_022 score:178 alignment:10M1D5M1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VQWKVDNALQ..GDSQSQSV.TEQDSK.DSTY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C723_007 score:55 alignment:6M1S[2,2]2M1D3M1I14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~LSNRPENTH.L.SNGTYDSLHTGQHADLT.A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2921 score:55 alignment:1I19M1D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QLH.A.SGQD.FW.AGVVVA..G..E..F..D..QGS.SSEK~~~~~~~~~~
>C797_005 score:52 alignment:8M4D15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LH.C.GVQD.Y.....VAA..H..V..V..Y.DQGS.SSQK~~~~~~~~~~
>C2411_002 score:63 alignment:19M2I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAVQAQVQAVPAED.EHDYSSPL.TFGAGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C632_002 score:53 alignment:1I26M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EKQE.ED.SEVVVA.GEFD.QG..SS..T.DK.L.QKL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C546_016 score:61 alignment:2I26M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KSD.D.FGAD.YL.GAVVVA..G..E..M..D.GAGS.SSEK~~~~~~~~~~~
>C778_005 score:52 alignment:10M1S[1,2]7M1D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.L.LGHC.GV.MWAVVVA..G..E..F..D..QGS.SSEK~~~~~~~~~~~
>C2179_004 score:106 alignment:1I18M1I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVQAEDLAVFYCH.QDYSS..PLTFGAGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2354_005 score:71 alignment:1I12M1I6M1I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVQAEDLAVPGEEHEDYSS..PLTFGAGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C312_012 score:155 alignment:25M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KAAEQLQS.GNSQE.SV.TEQNSK.DSTY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C439_007 score:182 alignment:25M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KVGNQLQS.GNSQE.SV.TEQDSK.DSTY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2146_005 score:73 alignment:1I17M2I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVQAEDLAVPEQD.EHNYSSPL.TFGAGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2379_003 score:97 alignment:1I18M1I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVQAEDLAVYSYH.QDYSS..PLTFGAGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1190_009 score:106 alignment:1I18M1I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVQAEDLAVYFCH.QNYSS..PLTFGAGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1108_004 score:190 alignment:7M1S[2,2]16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SQE.SV.TEENSK.DSTY.SL..SS..T.LT.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C180_002 score:139 alignment:9M1S[1,2]15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLEGNLQS.GGGSQD.GQ.TEQDSK.DSTY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C644_002 score:47 alignment:6M4D7M1D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.STSD.V.....VVA..G..E..F..D..QGS.SSEK~~~~~~~~~~
>C241_019 score:154 alignment:3M1S[2,2]20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLDGQLQS.GNSQD.GQ.TEQDSK.DSTY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C59_027 score:133 alignment:3M1S[2,2]5M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLDGQLQS.NSQSG.NV.TEQDSK.DSTY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C160_007 score:128 alignment:25M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KAAEQLQS.GQSQD.GQ.TEQDSK.DSTY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1095 score:190 alignment:3M1S[2,2]20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KVDGQLQS.GNSQE.SV.TEQDSK.DSTY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C796_005 score:117 alignment:15M1S[2,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VQKVNQENLQS.GNSQS.EV.TEQNSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C477_018 score:145 alignment:7M1D16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDNALQS..NSQD.QE.TEQDSK.DSTY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1483_004 score:49 alignment:2I9M3D5M1S[3,3]3M unique:False
~~~~~~~~~~~~~~~ANTPLGRASPE...SLPL.LSNHG.SF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C475 score:50 alignment:5M1S[2,2]2M9D5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E.TV.SEENSV................LC.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C315_028 score:65 alignment:1I3M1S[2,3]18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PAH.CGVTDCTAA..V..V..V..Y.DQGS.SSGVT~~~~~~~~~~
>Combined_1472 score:47 alignment:13M4D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FFESFG.DLS.SGE.A........L..L..GNP.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C927_008 score:167 alignment:22M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSK.DSTY.SL..SS..T.LT.L.SKAD.YQ.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1310_004 score:90 alignment:11M1S[1,2]3M3D4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGS.ASVV..C..L..L..DGGM.Y.P...KAVW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C866_005 score:176 alignment:22M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSK.DSTY.SL..SS..T.LT.L.SKAD.YE.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C239_008 score:149 alignment:22M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A..C..E..V..T.HQGL.SSPVT..K.SSTREEC
>C385_011 score:100 alignment:1I6M1D15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LDNALQS..DQEE.SV.TEQDSR.QMY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C672_009 score:55 alignment:13M2I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V.TTSDVV.VSTD.SEQGSS..S.EK.L.QKL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C360_009 score:176 alignment:22M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A..C..E..V..T.HQGL.SSPVT..K.SFGRNEC
>C750_013 score:49 alignment:3M1S[2,3]17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AH.CGVTDCVVG..L..S..V..M.DQGS.SSEK~~~~~~~~~~~
>C679_004 score:84 alignment:10M5D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..L..........SHSGQPL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1971_005 score:128 alignment:2I4M1D16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VKELL.N...AA..PSVFL..FPPSDE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C891_010 score:49 alignment:1I21M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KSAE.AE.TYQVSK.YEEL.QL..TA..G.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C929_006 score:148 alignment:2I21M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSSL.DSSY.SL..SS..T.LT.L.SKAD.YE.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C619 score:57 alignment:10M1S[2,2]9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LVS.GLSQG.QV.ETVQSS.PVTF.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C253_009 score:141 alignment:21M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KVGNQLQS.GNSQE.SV.TEQNSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C253_008 score:136 alignment:21M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KVEGNLQS.GNSQE.SV.TEQNSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C213_014 score:126 alignment:7M1S[2,2]10M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KVGNQLQG.SNSQE.SV.TEQDKS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C206_015 score:141 alignment:21M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLGNNLQS.GNSQE.SV.TEQDSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1090 score:138 alignment:7M1S[2,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KVGNQLQG.SNSQE.SV.TEQDSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C181_021 score:129 alignment:19M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLGNNLQS.GNSQE.SV.TEQDKS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C210_009 score:136 alignment:8M1S[2,2]8M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDNALQS.GSNQE.SV.TEQDKS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1246_007 score:106 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L..NNF.Y.GVRTPA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C625_002 score:55 alignment:7M1S[2,2]1M1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LVS.GLGQS.EVETVQSSP.VFTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_635 score:156 alignment:4I20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LREQLQS.GNSQE.SV.TEQDSK.DSTY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1284_003 score:83 alignment:1I4M1D6M1D8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAVGV.DRYGSG.YGTDASTF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C317_006 score:103 alignment:7M1D12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDNALES..DYKE.SV.TEQNSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1547_002 score:50 alignment:9M2D9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SKE.LT.TELD...DNLE.QL..SS..Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1523 score:160 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDNALQS.GNSQE.SV.TEQDSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C329_010 score:99 alignment:10M1D9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDNALQN.EDH.E.SV.TEQNSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C61_002 score:75 alignment:1M1S[2,2]6M1S[2,2]9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VNDVAND.VANTE.SV.TEQNSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C318_007 score:108 alignment:7M1D12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDNALQE..NDHE.SV.TEQNSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C310_008 score:119 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDNALQS.GDDDL.SV.TEQNSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_088 score:151 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDNALQS.GNSQE.SV.TEQNSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2766 score:139 alignment:18M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDNALQS.GNSQE.SV.TEQNKS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C606_010 score:47 alignment:5M1S[1,2]14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TSDVVVA.DAFD.QG..SS..T.DK.L.QK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1237 score:148 alignment:18M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDNALQS.GNSQE.SV.TEQDKS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C275_016 score:151 alignment:20M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDNALQS.GNSQE.SV.TQQDSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_957 score:42 alignment:10M4D5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AA..LQPAL..QPV.....LK.SGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C461_003 score:114 alignment:7M1D11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKVYY..V..E.....T.HQGL.SSPVT..K~~~~~~~
>C773_002 score:47 alignment:1I19M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VV.TAAHGS.DTTY.VH..SD..G.GP.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C423_007 score:114 alignment:7M1D11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKVYE..C..L.....T.HQGL.SSPVT..K~~~~~~~
>C99_006 score:122 alignment:9M1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKVYA..C..G..G..TLHQGL.SSPVT..K~~~~~~~
>C305_011 score:95 alignment:8M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKVGT..Q..S..TM.T.HQGL.SSPVT..K~~~~~~~
>Combined_1663 score:41 alignment:9M3D7M unique:False
~~~~~~~DTLL.KPLLV...EPEGLEK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1916_004 score:112 alignment:6M2I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKVHT..LTHE..V..T.HQGL.SSPVT..K~~~~~~~
>Combined_2854 score:89 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAVLDRGYGSGYGTDGSTF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C877 score:133 alignment:6M1S[2,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASV..AM..L..L..NNF.Y.PREAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C992_006 score:122 alignment:9M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSTY.SL..SS..T.TL.L.SKAD.KE.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2452 score:112 alignment:9M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ESSY.SL..SS..T.TL.L.SKGE.YE.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1600_008 score:120 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L..NDF.Y.PTLRN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C815 score:111 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGS.ASVV..C..L..L..NNF.Y.PAREK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2454 score:143 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L..NNF.Y.PREAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C243_009 score:83 alignment:8M1I4M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKVPE..N..G..SH.T.HQGS.LSPVT..K~~~~~~~
>C191_004 score:107 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKVTA..L..D..Q..H.HQGL.SSPVT..K~~~~~~~
>C144_002 score:115 alignment:6M1S[2,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKPVH..C....DL..T.HQGL.SSPVT..K~~~~~~~
>C1593_005 score:92 alignment:1M1S[2,2]16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAS.ASVV..C..L..L..NDY.M.PSLQR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C143_003 score:116 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKVYA..L..Q..C..S.HQGL.SSPVT..K~~~~~~~
>C1330_008 score:94 alignment:1I8M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FCH.QDYSS..PLTFGAGT.KLELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1273_012 score:79 alignment:3I7M1D11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NEHCF.YSSPL....TFGAGT.KLELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C638_005 score:44 alignment:12M1S[3,2]4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.PAQ..L..LQ..W...QVLSSQVPAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3412 score:36 alignment:8M8D3M unique:False
~~~~~~~~~~~~~~~~~~~~EPATGTGR.........DG.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C62 score:104 alignment:9M1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKVYA..G..G..Q..CSHQGL.SSPVT..K~~~~~~~
>C229_023 score:104 alignment:7M1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKVFD..H..QM.V..T.HQGL.SSPVT..K~~~~~~~
>C341_015 score:104 alignment:8M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKVPG..S..P..VQ.T.HQGL.SSPVT..K~~~~~~~
>C1289 score:93 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGS.ASVL..A..M..L..NNF.Y.PERAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C200_030 score:103 alignment:7M2I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKVVG..E..DQMV..T.HQGL.SSPVT..K~~~~~~~
>Combined_2390 score:125 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L..NNF.Y.PTLRN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C166_004 score:104 alignment:12M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKVPT..F..E..M..T.HQGS.LSPVT..K~~~~~~~
>C1599_006 score:107 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVM..Q..L..L..NNF.Y.PTLRN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C253_015 score:118 alignment:1I1S[2,2]15M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ANDVLQS.GNSQE.SV.TEQDKS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C896 score:133 alignment:6M1S[2,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASV..MA..L..L..NNF.Y.PREAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1512_006 score:125 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L..NNF.Y.PSLQR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C277_009 score:107 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKVEE..N..H..L..T.HQGL.SSPVT..K~~~~~~~
>Combined_2347 score:140 alignment:9M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSTY.SL..SS..T.TL.L.SKAD.YE.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2459 score:111 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L..DNM.Y.PTLRN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1241_008 score:109 alignment:11M1S[1,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L..DGGM.Y.PSLQR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1223_004 score:113 alignment:4M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.AVSV..C..L..L..NNF.Y.PTLRN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C313_008 score:104 alignment:7M1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKVNS..S..SM.V..T.HQGL.SSPVT..K~~~~~~~
>C305_015 score:116 alignment:19M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HKVPN..C..H..L..T.HQGL.SSPVT..K~~~~~~~
>C1048_007 score:126 alignment:9M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSTY.SL..SS..T.TL.L.SKGE.YE.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2934 score:103 alignment:12M2D1M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LY..Q.....TARS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1652_003 score:54 alignment:18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SQT.VSAV..C..L..P..NCD.H.QDLY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2076_005 score:115 alignment:1I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GT.V.AA..PSVFL..FPPSEK.ELN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C981_003 score:72 alignment:18M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PGA..L..LP..K...PSPQAN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1834_007 score:98 alignment:1I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DGT.ASAV..C..L..L..NNM.Y.PTLRN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1029_007 score:131 alignment:1I8M1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NSTY.SL..SS..T.TL.L.SKAD.YE.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C896_006 score:88 alignment:12M1D5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSK.DSTY.SK..PL..Y..T.L.SKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C673_003 score:53 alignment:1I18M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MLQV.SPYQV.SV.PYQVSS.NS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C663_005 score:88 alignment:2I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV.AA..PSVFL..FPPSGV.MGP.R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C343_018 score:46 alignment:14M1S[1,2]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NAEHA.LDVLE.LV.DLAGMEK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1108_013 score:46 alignment:6M1D11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SN.DLTY..L..TL..N.ND.L.TKLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1809_005 score:88 alignment:2I18M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSV.AA..PSVFL..FPPSTN.GNL.Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1986_003 score:94 alignment:1I1S[2,2]12M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSL.AA..PSVFL..FGVMDQ.ELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1765_008 score:44 alignment:18M unique:False
~~~~~~~~~~~~~~~LVLNGNPLTLFNEREPSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1546 score:143 alignment:1I18M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GT.V.AA..PSVFL..FPPSDE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1708_005 score:106 alignment:6M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..C..G..YL.T.HQGL.SSPVT..K~~~~~~~
>C1844_009 score:99 alignment:1I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVEA..T..L..Q..T.HQGL.SSPVT..K~~~~~~~
>C1930_003 score:125 alignment:2I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VSA.AA..PSVFL..FPPSDE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2170 score:107 alignment:2I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GYVYA..M..A..L..T.HQGL.SSPVT..K~~~~~~~
>C2228 score:98 alignment:2I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVAGT..Y..E..V..T.HQGL.SSPVT..K~~~~~~~
>C2630_002 score:116 alignment:2I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV.AA..PSVFL..FPPSDL.QEK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C545_006 score:126 alignment:5M1S[2,2]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..C..E....SL.HQGL.SSPVT..K~~~~~~~
>C670_007 score:88 alignment:6M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYM..D..D..HL.T.HQGL.SSPVT..K~~~~~~~
>C717_006 score:100 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYG..D..Y..Y..T.HQGL.SSPVT..K~~~~~~~
>C758_007 score:106 alignment:4M1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..GD.E..M..T.HQGL.SSPVT..K~~~~~~~
>C780_006 score:106 alignment:6M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..C..G..CY.T.HQGL.SSPVT..K~~~~~~~
>C1570_005 score:96 alignment:6M2I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..E..D..DHLT.HQGL.SSPVT..K~~~~~~~
>C800_005 score:109 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..E..Y..M..T.HQGL.SSPVT..K~~~~~~~
>Combined_1753 score:109 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..S..Y..M..T.HQGL.SSPVT..K~~~~~~~
>C1030_005 score:82 alignment:17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LY..G...SPSSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1228_003 score:76 alignment:6M1I4M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYS..G..D..YL.T.HQGS.LSPVT..K~~~~~~~
>C1373_005 score:96 alignment:6M2I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..G..D..TALT.HQGL.SSPVT..K~~~~~~~
>C1831_005 score:88 alignment:6M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYS..G..F..LH.T.HQGL.SSPVT..K~~~~~~~
>C121_002 score:109 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..D..C..L..T.HQGL.SSPVT..K~~~~~~~
>C2066_007 score:105 alignment:4M2I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYG..SVME..V..T.HQGL.SSPVT..K~~~~~~~
>C2431 score:87 alignment:6M2I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYG..S..S..YNLT.HQGL.SSPVT..K~~~~~~~
>C2574 score:105 alignment:4M2I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..PNME..L..T.HQGL.SSPVT..K~~~~~~~
>C388_006 score:109 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..D..Y..Q..T.HQGL.SSPVT..K~~~~~~~
>C549_008 score:118 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYV..C..E..A..T.HQGL.SSPVT..K~~~~~~~
>C894_005 score:97 alignment:6M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..S..D..CY.T.HQGL.SSPVT..K~~~~~~~
>C2635 score:120 alignment:2I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV.AA..PSVFL..FPPSNE.ELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1402_004 score:51 alignment:3M4D6M1D3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YQL.....S.PQL..L..G...Q...AS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1374_005 score:115 alignment:4M1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..TQ.E..V..T.HQGL.SSPVT..K~~~~~~~
>C729_006 score:109 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYG..M..D..V..T.HQGL.SSPVT..K~~~~~~~
>C89_008 score:126 alignment:4M1S[2,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..C....DL..T.HQGL.SSPVT..K~~~~~~~
>Combined_3976 score:125 alignment:2I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV.AA..PSVFL..FPPSNE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2406 score:124 alignment:1S[2,2]15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVA..C..E..V..T.HQGL.SSPVT..K~~~~~~~
>C210_007 score:106 alignment:5M1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..S..DS.V..T.HQGL.SSPVT..K~~~~~~~
>C717_005 score:96 alignment:6M2I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..E..D..NHLT.HQGL.SSPVT..K~~~~~~~
>C793_005 score:97 alignment:3M1I14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYGS.C..M..L..T.HQGL.SSPVT..K~~~~~~~
>C1468_004 score:105 alignment:4M2I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYG..SSYE..V..T.HQGL.SSPVT..K~~~~~~~
>C216_011 score:109 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..E..A..M..T.HQGL.SSPVT..K~~~~~~~
>C708_005 score:115 alignment:4M1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..TY.E..V..T.HQGL.SSPVT..K~~~~~~~
>C308_011 score:106 alignment:1S[2,2]15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVA..Y..E..M..T.HQGL.SSPVT..K~~~~~~~
>C612_006 score:100 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..G..N..N..L.HQGL.SSPVT..K~~~~~~~
>Combined_1776 score:106 alignment:3M1I14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYAG.C..Y..L..T.HQGL.SSPVT..K~~~~~~~
>C119 score:109 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYV..C..A..E..T.HQGL.SSPVT..K~~~~~~~
>C627_008 score:118 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..A..E..M..T.HQGL.SSPVT..K~~~~~~~
>C662_008 score:96 alignment:3M2I14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYAGCD..A..H..T.HQGL.SSPVT..K~~~~~~~
>C681_003 score:95 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYS..S..Y..Y..T.HEGL.SSPVT..K~~~~~~~
>C724_004 score:90 alignment:1I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVAG..D..N..Y..T.HQGL.SSPVT..K~~~~~~~
>C780_005 score:100 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYS..T..Y..Y..T.HQGL.SSPVT..K~~~~~~~
>C881_005 score:97 alignment:6M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..D..S..CY.T.HQGL.SSPVT..K~~~~~~~
>C893_007 score:54 alignment:1S[2,2]10M1D4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVM..G..D..V..T.HQSK.E.PVT..K~~~~~~~
>C907_004 score:88 alignment:1S[2,2]15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVE..S..Y..Y..T.HQGL.SSPVT..K~~~~~~~
>C913_004 score:100 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYG..D..Q..M..T.HQGL.SSPVT..K~~~~~~~
>C1332_005 score:88 alignment:6M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYS..G..S..YY.T.HQGL.SSPVT..K~~~~~~~
>C161_010 score:136 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALQS.GNSQE.SV.TEQDSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C622_008 score:106 alignment:4M1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..GS.E..M..T.HQGL.SSPVT..K~~~~~~~
>C641_008 score:109 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..T..T..Q..T.HQGL.SSPVT..K~~~~~~~
>C667_005 score:97 alignment:6M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..D..D..MY.T.HQGL.SSPVT..K~~~~~~~
>Combined_1601 score:109 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..A..M..E..T.HQGL.SSPVT..K~~~~~~~
>C884_007 score:105 alignment:1I9M1S[2,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KSS.DSKY.SL..ST..S.LT.L.SKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2421 score:115 alignment:2M1I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SKEDSSY.SL..SS..T.LT.L.SKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2381 score:126 alignment:1I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KSD.DSTY.SL..SS..T.LT.L.SKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C682_013 score:79 alignment:2I3M1S[2,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KKYQPAN.S.PQL..L..LY..Q...KGTE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C344_010 score:80 alignment:7M1D9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDNALQS..NDRY.SS.TEQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C444_014 score:124 alignment:10M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..C..E..V..T.HQGS.LSPVT..K~~~~~~~
>Combined_1277 score:134 alignment:2I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV.AA..PSVFL..FPPSDE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C335_015 score:104 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDNALQS.GNTQD.AH.TEQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2449 score:136 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSK.DSTY.SL..SS..T.LT.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C906_006 score:115 alignment:15M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSK.NSTY.SL..SS..T.LT.L.KS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C984_007 score:88 alignment:1I10M1D6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KSD.DSTY.SL..KM....LT.L.SKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C507 score:45 alignment:1I17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MLQV.SPYQV.SV.PYQVSN.S~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C389_013 score:124 alignment:15M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..C..E..V..T.HQGL.SSPVK..T~~~~~~~
>C1622_006 score:74 alignment:1S[2,2]15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GST.ASVV..C..L..L..DPN.P.DRP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C465 score:43 alignment:4M1S[2,2]11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GN.R.ELQ..N..LL..P...ASTGAAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1052_011 score:44 alignment:1I17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KE.QLF.QEN.GELV..L..D..R..NDF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2663 score:63 alignment:17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSK.YNSL.TL..NN..D.LT.L.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C347 score:96 alignment:4M2I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..GDDE..S..H.HQGL.SSPVT..K~~~~~~~
>Combined_1102 score:107 alignment:2M1D14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VY...C..E..L..T.HQGL.SSPVT..K~~~~~~~
>C311_011 score:97 alignment:1S[2,2]15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVD..G..M..V..T.HQGL.SSPVT..K~~~~~~~
>Combined_2931 score:106 alignment:2I3M1S[2,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KKYQPAN.S.PQL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C559_014 score:109 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYG..S..E..E..T.HQGL.SSPVT..K~~~~~~~
>Combined_1103 score:97 alignment:6M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..D..D..YM.T.HQGL.SSPVT..K~~~~~~~
>Combined_1490 score:122 alignment:2I13M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV.AA..PSVFL..FPPSDQ.ELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C780_011 score:115 alignment:2M1I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SKSDSKY.SL..SS..T.LT.L.SKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C790_008 score:134 alignment:2I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGSK.DSTY.SL..SS..T.LT.L.SKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C718_006 score:88 alignment:1S[2,2]15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVT..S..Y..M..T.HQGL.SSPVT..K~~~~~~~
>C728_005 score:100 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYT..E..Q..Q..T.HQGL.SSPVT..K~~~~~~~
>C790_006 score:109 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..E..M..Y..T.HQGL.SSPVT..K~~~~~~~
>C893_009 score:106 alignment:5M1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..Y..DM.V..T.HQGL.SSPVT..K~~~~~~~
>C896_004 score:106 alignment:1S[2,2]15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVA..T..E..T..T.HQGL.SSPVT..K~~~~~~~
>C905_004 score:106 alignment:1S[2,2]15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVA..D..Y..V..T.HQGL.SSPVT..K~~~~~~~
>C922_008 score:106 alignment:10M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..C..Y..M..T.HQGS.LSPVT..K~~~~~~~
>Combined_1455 score:45 alignment:1I11M1S[2,2]4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KQEL.FQENG.ELVDLMQEK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1393_005 score:105 alignment:4M2I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..GGTE..L..T.HQGL.SSPVT..K~~~~~~~
>C1664_005 score:113 alignment:4M2I1S[2,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..CGY..DL..T.HQGL.SSPVT..K~~~~~~~
>C1854_004 score:106 alignment:3M1I14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYSY.C..Q..V..T.HQGL.SSPVT..K~~~~~~~
>C1148_012 score:55 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..E..E..M..EVT.H.QGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1872_009 score:50 alignment:10M1D3M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KAYAQ.Y.LQV..L...Y..Q...ATSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C358 score:97 alignment:6M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..D..N..YM.T.HQGL.SSPVT..K~~~~~~~
>Combined_1461 score:109 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..M..A..E..T.HQGL.SSPVT..K~~~~~~~
>C794_012 score:51 alignment:12M1S[2,2]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~TLSLNNDLTL.LKNSK.YN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C617_005 score:97 alignment:1S[3,2]7M1I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NAT.KLELK.ASV.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C346_002 score:118 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..A..C..V..T.HQGL.SSPVT..K~~~~~~~
>C309_002 score:124 alignment:3M1S[2,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..E..C..V..T.HQGL.SSPVT..K~~~~~~~
>C206_002 score:43 alignment:10M1D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL..HP..D.LT.G.DK.D.KE.QWK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C526_005 score:118 alignment:10M1S[3,3]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..FPPSDE.QLK.GTS.ASVV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1567 score:62 alignment:4M2I8M1D4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYG..SSYE..V..T.HQSK.E.PVT..K~~~~~~~
>C161_022 score:95 alignment:2M1D7M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VY...C..E..L..T.HQGS.LSPVT..K~~~~~~~
>C824_013 score:117 alignment:1I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KSD.NSTY.SL..SS..T.LT.L.SKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2175_002 score:93 alignment:2I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV.AA..PSVML..FGTMEE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1622 score:109 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYG..D..M..V..T.HQGL.SSPVT..K~~~~~~~
>C619_008 score:118 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..P..E..A..T.HQGL.SSPVT..K~~~~~~~
>C484_005 score:118 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..C..N..L..T.HQGL.SSPVT..K~~~~~~~
>C418_019 score:45 alignment:1I17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TS.DVVVA.AD.FDQGSK.DST~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3878 score:88 alignment:6M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYD..G..Y..YL.T.HQGL.SSPVT..K~~~~~~~
>C1484_014 score:38 alignment:2M4D2M1S[2,2]7M unique:False
~~~~~~~~~~~~~~~~VT....ALVTCAVQQTL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C539_005 score:109 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYT..S..D..V..T.HQGL.SSPVT..K~~~~~~~
>Combined_2771 score:97 alignment:6M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..T..D..CY.T.HQGL.SSPVT..K~~~~~~~
>C1500_003 score:102 alignment:2I17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV.AA..PSVFL..FPPSEK.GLW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_009 score:136 alignment:17M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYA..C..E..V..T.HQGL.SSPVT..K~~~~~~~
>C874_002 score:73 alignment:17M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LG..N...RPPAN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C370_020 score:108 alignment:4M1S[2,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VYS..S....DL..T.HQGL.SSPVT..K~~~~~~~
>C3037_002 score:44 alignment:7M3D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SS..T.ST.S.S....YS.TPGVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1713 score:100 alignment:1M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAS.ASVV..S..E..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C491_002 score:116 alignment:1M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGPQ.S.PQL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2183_003 score:73 alignment:10M1S[1,2]1M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVG..R..F..M..GGDY.F.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2321_002 score:92 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ANAV..S..E..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2375_003 score:79 alignment:9M1D1M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVR..F..M.....NGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2409_002 score:80 alignment:1M1S[2,2]7M1S[1,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAS.ASVV..S..E..L..GGPM.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2452_002 score:79 alignment:9M2I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASAD..D..KDTL..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C742_004 score:106 alignment:1I3M1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TYA..YM.E..V..T.HQGL.SSPVT..K~~~~~~~
>C2498_003 score:101 alignment:7M2I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVVGAC..H..L..DNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2504 score:104 alignment:8M1I3M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..CH.L..L..NFN.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2558 score:107 alignment:8M1I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..ND.L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1981_008 score:105 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L..DML.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1751 score:126 alignment:3M1S[1,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGAG.S.PQL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_182 score:118 alignment:1M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAS.ASVV..C..L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3729 score:45 alignment:5M1D4M2I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QASSG..S.PGLVRL..LA..Q...AT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C781_005 score:118 alignment:1I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SYA..Y..E..V..T.HQGL.SSPVT..K~~~~~~~
>C583_002 score:69 alignment:16M unique:True
~~~~~~~~~~~~KLLLSSPAAPATLSNR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2164_003 score:104 alignment:1M1S[2,2]5M1I3M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSA.ASVV..CH.L..L..NGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1994_006 score:89 alignment:1S[2,2]14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSS.AAQV..C..L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1696 score:123 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L..NDF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2090_003 score:45 alignment:1I16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VTDE.QLK.EVF.EDAA..E..L..R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1175_006 score:55 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SK.NYSL.TL..NN..D.LT.L.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1403_003 score:47 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QGT.SGS.PSVV..R..V..L..VVA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1213 score:126 alignment:2I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EKAA..PSVFL..FPPSDE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_171 score:114 alignment:2I12M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KEAA..PSVFL..FPPSDQ.ELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C570_008 score:118 alignment:1I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AYA..M..E..V..T.HQGL.SSPVT..K~~~~~~~
>Combined_091 score:101 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LY..N...VSSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C690 score:49 alignment:5M4D7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGVPD....GRYGTGY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C723 score:69 alignment:2I13M1I3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KEAA..PSVFL..FPGAGNLQEK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C935_017 score:117 alignment:11M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..T..L..L..NGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C793_003 score:47 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~LACASGVSD.CHSCG.PL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1797_006 score:107 alignment:12M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KFGQ.S.PQL..L..LY..Q...SATR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3967 score:128 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1908_006 score:85 alignment:11M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVG..R..F..F..DGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_038 score:101 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LT..Q...FSSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_225 score:126 alignment:2I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KEAA..PSVFL..FPPSDE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1685 score:96 alignment:9M1I2M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..G..SA.L..NGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1686 score:76 alignment:11M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.AGGR..H..D..L..DGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2121_005 score:116 alignment:1S[2,2]14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GST.ASVV..C..L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C839_009 score:116 alignment:13M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LY..Q...ATSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1426 score:105 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..S..E..L..NDF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1469_006 score:111 alignment:14M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L..DNF.Y.RP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_228 score:110 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..S..E..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C867_004 score:45 alignment:7M3D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YTH.PALL......FGTGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_998 score:54 alignment:1I16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NSK.YDSL.TL..NN..D.LT.L.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3955 score:108 alignment:2I16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EKAA..PSVFL..FPPSDE.KLQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1420_007 score:118 alignment:2M1S[2,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPAN.S.PQL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C236_005 score:112 alignment:4I14M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LREQLQS.GNSQE.SV.TEQDKS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1783 score:123 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L..DNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1936_005 score:80 alignment:11M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ATAH..R..D..L..DGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2014_005 score:99 alignment:11M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASGE..H..L..L..NGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C460_018 score:92 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LY..N...VSRS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2434_003 score:90 alignment:10M1S[1,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..S..E..L..GGPM.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2479 score:88 alignment:1M1S[2,2]5M1I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAS.ASVS..GM.L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2518 score:98 alignment:7M1I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVTD.C..F..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1837_008 score:46 alignment:8M1S[2,1]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QALQW..P.ALQPV.LSGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C841_007 score:109 alignment:1I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KSQ.DSSY.SL..SS..T.LT.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1482_014 score:117 alignment:2I16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EKAA..PSVFL..FPPSDE.QLQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2092_004 score:98 alignment:1S[2,2]14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GST.ANAV..C..L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1169_011 score:63 alignment:2I16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NNDLT.LLTL.SL..NS..T.LT.N.S~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1291_004 score:76 alignment:7M2D7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TY.DSTV.S....S..T.LT.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C510_004 score:100 alignment:1I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YYA..P..A..E..T.HQGL.SSPVT..K~~~~~~~
>C1116 score:110 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGS.ASLV..C..L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1587 score:105 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..S..E..L..DNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3769 score:44 alignment:7M4D5M unique:False
~~~~~~~~~~~~~~~~~~~~EPATGTY....SL.LHM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C668 score:104 alignment:1M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAS.ASVV..C..L..L..DNM.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1928_005 score:117 alignment:2I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KEAA..PSVFL..FPPSDQ.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1581 score:105 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGS.ASLV..C..L..L..DNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1501 score:83 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..S..E..L..LMD.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_982 score:45 alignment:7M4D5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV.KASL.......A..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2170_002 score:114 alignment:8M1I3M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..CH.L..L..NGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2335_005 score:92 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L..TCL.M.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1795 score:81 alignment:9M1D6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVR..F..M.....NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2408_003 score:82 alignment:1M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAS.ASVV..T..D..L..PNM.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C704 score:116 alignment:12M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L..NNY.F.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2469_002 score:107 alignment:8M1I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVA..CH.L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2486_004 score:107 alignment:8M1I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVN..CH.L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2549_003 score:106 alignment:8M2I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..SMFL..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3442 score:45 alignment:3M3D10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Q...AS...SGSPARLLSL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_221 score:56 alignment:1M1S[2,2]11M1I2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAS.ASVV..S..D..L..DGP.HMPR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C895 score:88 alignment:1I5M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GYA..Y..M..NL.T.HQGL.SSPVT..K~~~~~~~
>C2457 score:55 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSK.YNSL.TL..NN..D.LT.L.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2334_002 score:109 alignment:1M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAS.ASVV..C..L..L..NNE.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1464_005 score:98 alignment:8M1I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVT..YM.L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C868_008 score:118 alignment:1I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KSD.DSTY.SL..SS..T.LT.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C910 score:65 alignment:1S[3,3]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTS.ASVV..S..E..L..EMV.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C560_022 score:110 alignment:13M1S[3,3] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LY..Q...ATRS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C967_004 score:109 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGT.ASVV..C..V..L..DNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_344 score:47 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGYDCV.PALQP..V.LSGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1519 score:118 alignment:3M1S[2,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.GTVV..C..L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2211_003 score:108 alignment:2I12M1S[3,3]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EKAA..PSVFL..FPPSDQ.LEK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C741_005 score:52 alignment:9M1I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGS.ASVV..S..AD.L..DTK.Y.ER~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1718 score:110 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVC..Q..L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1576_006 score:96 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..T..L..L..DLM.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2436 score:126 alignment:11M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L..NGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C876_003 score:95 alignment:1M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAS.ASVV..C..L..L..DNF.M.LR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C916_005 score:112 alignment:2I16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EKAA..PSVFL..FPPSNE.ELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C936_006 score:56 alignment:1M1S[2,2]11M1I2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSA.ASVV..S..D..L..DGP.HMPR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3956 score:109 alignment:8M1I3M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGT.ASVV..CH.L..L..NGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1083_003 score:110 alignment:3M1S[3,3]10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.VGTV..C..L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2303_002 score:91 alignment:11M1S[1,2]2M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..S..E..L..DGGF.Y.RP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2817 score:116 alignment:14M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L..NNF.Y.RP~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2158_003 score:117 alignment:2I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EKAA..PSVFL..FPPSNE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_169 score:128 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1449 score:116 alignment:1M1S[2,2]8M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAS.ASVV..C..L..L..NGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C789_007 score:108 alignment:2I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EKAA..PSVFL..FPPSDL.QEK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1190_007 score:73 alignment:1M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAS.ASVV..N..T..L..TMQ.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1712 score:110 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ANAV..C..L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1466 score:71 alignment:1S[2,2]14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GST.ASVV..S..E..L..EMV.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C288_004 score:115 alignment:4I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LRQELQS.GNSQE.SV.TEQNSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2930 score:110 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YV..C..E..L..T.HQGL.SSPVT..K~~~~~~~
>C1816_009 score:103 alignment:2I16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EKAA..PSVFL..FPPSDK.ELQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1374 score:87 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..S..E..L..NDF.L.MR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2739_002 score:74 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..S..E..L..NKE.H.PW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C693_006 score:106 alignment:1M2S[2,2]6M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAS.GTVV..C..L..L..NGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1387 score:110 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..D..T..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C893_006 score:81 alignment:2I16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KEAA..PSVFL..FPGSQL.FHK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C962_004 score:116 alignment:6M1S[2,2]3M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASV..MA..L..L..NGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1511 score:108 alignment:11M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..S..E..L..NGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1782 score:103 alignment:11M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..S..E..L..DGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1447 score:95 alignment:1M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAS.ASVV..C..L..L..DML.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1136_004 score:118 alignment:1M1S[2,2]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSA.ASVV..C..L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C331_007 score:92 alignment:16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PQL..L..LN..V...YSSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3664 score:116 alignment:2M1S[2,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPQG.S.PQL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1510_007 score:96 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..T..L..L..DML.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2411 score:75 alignment:2I5M2I8M1D2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVPSVFPSVFPPSVE.QL..SG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2899 score:59 alignment:1I16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NSK.YSNL.TL..DN..N.LT.L.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1207_004 score:87 alignment:1S[3,3]13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTS.ASVV..C..L..L..DNF.M.LR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1338_004 score:83 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..S..E..L..VME.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1548 score:98 alignment:1M1S[2,2]8M1S[1,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAS.ASVV..S..E..L..NGGF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1303_005 score:63 alignment:1I16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NSK.YSNL.TL..NN..D.LT.L.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1314_005 score:92 alignment:16M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ANAV..D..T..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3854 score:58 alignment:1I16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KSN.YSDL.TL..NN..D.LT.L.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1217_007 score:49 alignment:1I16M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LTY.NSDL.TL..NN..N.LT.L.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1678_002 score:54 alignment:5M3D8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ATV.KL....L.N.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1422_008 score:86 alignment:3M1S[2,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGS.GTVV..T..D..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C851_018 score:115 alignment:3I5M1S[1,2]9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MSCPGQ.S.PGAL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C468 score:96 alignment:1S[2,2]2M1I11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPQ.SKPQL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_323 score:51 alignment:15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL.TSKY.TL..NN..D.LT.L.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_212 score:98 alignment:4I15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSMSPGQ.S.PQL..L..LY..Q...TSAR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C150_019 score:75 alignment:15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.S.PQL..L..LY..G...SSVGR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2564 score:53 alignment:6M1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SN.DLTYLTL..NN..D.LT.L.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C209_010 score:106 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A..C..E..V..T.HQGV.STPVT..K~~~~~~~
>C1299 score:47 alignment:15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SK.YDSL.TL..NN..D.LT.L.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C889_019 score:117 alignment:3I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TMSPGQ.S.PQL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1288_006 score:114 alignment:4I5M1S[1,2]9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSMSPGQ.S.PGAL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_633 score:120 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A..C..E..V..T.HQGL.SSPVT..K~~~~~~~
>C1331_007 score:55 alignment:4M5D6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GS.KL........AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1079_012 score:52 alignment:10M2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SN.DLTY.KL..TLNND.LT.L.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3915 score:52 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SQT.VSAV..C..L..E..NDV.H.M~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1275_004 score:107 alignment:3I11M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TMSPGQ.S.PQL..L..LY..Q...GTTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C635_015 score:106 alignment:2I8M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SFA..C..E..V..T.HQGS.LSPVT..K~~~~~~~
>Combined_1341 score:120 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SL..SS..T.LT.L.SKAD.YE.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C545_007 score:98 alignment:1I7M1I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGQ.KLELKGT.V.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C814_007 score:80 alignment:1I9M1I6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGQ.KLELK.L.GSAA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2422_003 score:92 alignment:1I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AGS.ASVV..N..N..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1430_010 score:52 alignment:2M1S[2,2]3M2D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GS.LKKLN.....AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1686_004 score:108 alignment:3I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DNLA..C..A..V..T.HQGL.SSPVT..K~~~~~~~
>C2073_003 score:100 alignment:2I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AME..H..E..V..T.HQGL.SSPVT..K~~~~~~~
>C2390_003 score:101 alignment:1I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGT.ASVV..N..N..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C958_009 score:41 alignment:8M2D5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DGR.DQDY.S....S..P.LT.F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1474_003 score:110 alignment:1I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NGT.ASAV..C..L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1264_003 score:117 alignment:3I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MSCPGQ.S.PQL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C651 score:116 alignment:4I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSMSPGQ.S.PQL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C820_009 score:76 alignment:1I7M1I4M2I4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSV.KLELKGT.V.AANAPSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2140 score:44 alignment:2M1S[2,3]9M1S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.QAAV..T..AY..H...ASQAAGS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1218_004 score:108 alignment:12M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PGQ.S.PQL..L..LY..Q...ATSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2053 score:89 alignment:1I8M1I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGQ.KLELK.ASV.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_227 score:39 alignment:15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A..E..F..V..E.VTKL.VSELT..K~~~~~~~
>C1193_003 score:101 alignment:1I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QGS.ASAV..C..L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C675_006 score:75 alignment:2I10M1D4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SFA..C..E..V..T.HQSK.E.PVT..K~~~~~~~
>C667_009 score:39 alignment:15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~LQQASLPLL.SNSHG.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1564_009 score:99 alignment:3I15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQSA..PSVFL..FPPSDE.KLQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2588_003 score:92 alignment:1I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGT.ASVF..N..N..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C249_021 score:108 alignment:13M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A..C..E..V..T.HQGL.SSPVK..T~~~~~~~
>C748_006 score:73 alignment:6M1S[1,2]4M2I4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PGAL..L..LGLGQ...HVD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2571_002 score:80 alignment:1I8M1I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GGT.ASVF..G..GN.L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C606_016 score:48 alignment:15M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..G..S..N..MVE.T.H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C934_002 score:55 alignment:2M1I6M1I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CFHQDYSS..PLTFGAGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2250 score:117 alignment:3I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQSA..PSVFL..FPPSDE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1365 score:105 alignment:3I11M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQSA..PSVFL..FPPSDQ.ELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C686_013 score:101 alignment:1I15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KGQ.KLELK.T.Q.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2145 score:120 alignment:15M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSTY.SL..SS..T.LT.L.SKA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_360 score:49 alignment:3M1S[3,3]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.T.AP..SAVML..PSASD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C212_025 score:92 alignment:1S[2,2]8M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AN.S.PQL..L..LY..Q...GTTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C891_002 score:40 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SQT.VSAV..C..L..E..ECH.W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1251 score:49 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQ..Q...ASLPLGQTPDR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_044 score:112 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.S.PQL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C185_016 score:88 alignment:1S[2,2]9M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QG.S.PQL..L..LY..Q...ATSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1847_008 score:39 alignment:6M1S[2,2]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ARVT..A..L....VQRD.Y.DTL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1487_005 score:40 alignment:1I2M1I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MLTEL.EKAL.NS.LLDVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3132 score:102 alignment:1S[2,2]12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AN.S.PQL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C685_009 score:40 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~ASLPLLSNQSC.KKY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_155 score:85 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.S.PGR..Y..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2161_005 score:40 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KNNVPA..L..Q..P..A.LQGL~~~~~~~~~~~~~~~
>C876_019 score:53 alignment:3I4M4D6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSVT.KLN.......AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3810 score:49 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQ..Q...ASLPLATNPDR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1900_006 score:79 alignment:2I5M2I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DLPSVFPSVFPPSDQ.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_172 score:79 alignment:2I5M2I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TKPSVFPSVFPPSNE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3942 score:79 alignment:2I5M2I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVPSVFPSVFPPSDQ.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2804 score:79 alignment:2I5M2I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVPSVFPSVFPPSNE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C573_013 score:40 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..LD..M...ELMGASGVSS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1760 score:76 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.S.GRP..Y..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C394_003 score:83 alignment:2I14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LCY..S..S..T.HQGL.SSPVT..K~~~~~
>Combined_2402 score:29 alignment:4M6D4M unique:False
~~~~~~~~~~~~~~~~~~~~~~ASLS......E.LHC~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1154_004 score:76 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.S.GPR..Y..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C779_004 score:49 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQ..Q...ASLPLASQPDR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2741_005 score:46 alignment:6M1S[2,2]2M1D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SLDLSLDLAE.VGK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C233_026 score:80 alignment:2M1I5M1D6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQLS.PQL..L...Y..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C299_002 score:40 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SQT.VSAV..C..L..P..SAS.N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C400_006 score:94 alignment:1S[3,3]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SG.Q.PQL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C116 score:100 alignment:11M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.S.PQL..L..LY..Q...ATSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C327_013 score:103 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C..E..L..T.HQGL.SSPVT..K~~~~~
>C769_002 score:76 alignment:2I5M2I4M1S[2,2]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVPSVFPSVFPPSED.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C182 score:44 alignment:1I8M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LC..V..V..L.HEEPVSEKVT..K~~~~~
>C984_006 score:48 alignment:1I14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NAA..VSVYL..DYPNAV.Q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2472 score:65 alignment:2I5M2I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVPSVFPSVFPPNSE.ELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1438 score:112 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSTY.SL..SS..T.LT.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1202_004 score:62 alignment:8M1D2M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSTY.SL..QM....LT.S.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1706 score:88 alignment:2I5M2I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVPSVFPSVFPPSDE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C996_002 score:75 alignment:12M3I2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPGQ.S.PEL..L..LS..HKPPAS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C296_009 score:94 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSTY.SL..SG..M.LT.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1156_002 score:88 alignment:2I5M2I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TKPSVFPSVFPPSDE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2647 score:49 alignment:14M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQ..Q...ASLPLANTPDR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C923_012 score:112 alignment:14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YQKKPGQ.S.PQL..L..LY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C895_005 score:76 alignment:2I5M2I5M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVPSVFPSVFPPSDQ.ELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C994_005 score:56 alignment:10M1D3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DSTY.SL..GY..Q.L..L.SR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2012_004 score:54 alignment:3M1S[2,2]9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ESLS.YL..NN..D.LT.L.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1546_007 score:74 alignment:2I14M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAQ.KLELK.A.S.QA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1015_005 score:50 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SQT.VSAV..C..L..Y..NSD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1340_006 score:94 alignment:1S[2,2]11M unique:True
~~~NLVMTQTP.KFLLV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C106_006 score:92 alignment:4M1S[2,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.L.SKDA.YE.KHKVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C166_012 score:77 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.L.SKGY.EE.KHKVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3742 score:36 alignment:9M1S[3,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~M.EGLAS..P.MGNAT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1163 score:103 alignment:1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ME..V..T.HQGL.SSPVT..K~~~~~
>C115_021 score:92 alignment:5M1I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSPVTN.K.SFGRNEC
>C95_006 score:77 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSPVT..K.SSTREEC
>Combined_2991 score:73 alignment:4I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RYAAQ.Y.LLL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C138_010 score:75 alignment:5M1D7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YQKKP.Q.S.PQL..L..G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2052 score:94 alignment:4M1S[2,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QKKPAN.S.PQL..L..LY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C890_014 score:43 alignment:2I8M2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NNDLTN.KL..TSMKD.LT.L.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2236 score:48 alignment:1I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSDL.TL..NN..N.LT.L.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2032 score:104 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSPVT..K.SFGRNEC
>C599_005 score:56 alignment:2M1S[2,2]9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..NFN.Y.PTRNLVQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C105_009 score:69 alignment:6M1I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.L.SKAEGYS.VHKVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C107_011 score:68 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSPVT..K.SGRPYEC
>C274_010 score:54 alignment:13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VRP..FPPVSE.LLK.T~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1985 score:104 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.L.SKAD.YE.KHKVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C183_018 score:41 alignment:6M1S[3,2]4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLGLA.K.LQ..KAVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C188_009 score:50 alignment:2I3M2D8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SKT.L.E..A.YD.KHKVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C190_030 score:45 alignment:13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EPATGTGGSRFLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C281_015 score:65 alignment:6M1I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSPVT..ELSFNRGEC
>C52_005 score:77 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.L.SKEA.YD.KHKVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3959 score:38 alignment:3M1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LF.LVSLGD.YE.VLKN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1627 score:41 alignment:10M2I3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SQT.VSAV..C..L..HGMDNW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1792 score:104 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASVV..C..L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2014_008 score:86 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVL..C..L..V..NNF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C387_002 score:91 alignment:1I11M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ME..V..T.HQGL.SSPVK..T~~~~~
>C1266_004 score:91 alignment:4I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SREEC.S.PQL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C342_008 score:40 alignment:1M1S[2,2]10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DQGSQS.ELVQG.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C168_008 score:40 alignment:13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~EPATGTGGRDFLM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C531_015 score:40 alignment:13M unique:False
~~~~~~~~~~~~~~~~~~~~EPATGTMRSVTAM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1125_007 score:71 alignment:1S[2,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AN.S.PQL..L..LY..Q...WTK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1336_011 score:82 alignment:4I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DYSSP..L.TFGAGT.KLELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C279_007 score:94 alignment:1I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSEY.SL..SS..T.LT.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C66_006 score:81 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.L.SKAE.YL.EHKVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1427_007 score:64 alignment:4I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DYSSP..L.TFGAGT.KLEKL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1044_008 score:45 alignment:10M2I3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SQT.VSAV..C..L..PHEDDF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1877 score:40 alignment:1I13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DYCV.PALQP..V.LSGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2271 score:94 alignment:1S[2,2]11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTVV..C..L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2051 score:68 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..NNF.Y.PTRNLVQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1961_010 score:38 alignment:5M1S[3,2]1M1S[2,2]2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LEVP.A.LQ..PVSRL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C51_006 score:60 alignment:8M1I5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.L.SKGE.GMSKHKVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C455 score:41 alignment:13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VQGDKWLQVQS.GN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2169 score:100 alignment:4I13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SMEHE..V..T.HQGL.SSPVT..K~~~~~
>Combined_1571 score:104 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E..V..T.HQGL.SSPVT..K~~~~~
>C594_005 score:41 alignment:13M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLDMALCA.GASGV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_150 score:46 alignment:8M1I5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ETV.SE..ES..NVLC.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C157_020 score:77 alignment:13M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.L.SKAY.ED.KHKVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C432_008 score:55 alignment:5M1S[3,3]4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGVPDGRFSSGY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2670 score:47 alignment:3I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLSSKY.TL..NN..D.LT.L.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2144 score:41 alignment:1I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QGTSGSPATLRVL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C127 score:87 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASGVPDRFGSSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3319 score:37 alignment:3M1S[1,2]8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GLCGLYCGLGSTA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C290_007 score:41 alignment:1I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGPDGSPATLRVL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1315_005 score:39 alignment:10M1S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QGV.SLQDA..K.SGF~~~
>C778_013 score:34 alignment:1I5M3D4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VL..DSF.C....AKVQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2033 score:82 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.SKGE.YE.KHKVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1282 score:37 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VDL..LNQELE.FLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1111_003 score:75 alignment:1I5M1D6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LS.PQL..L...Y..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C751_016 score:36 alignment:5M1S[2,1]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D..L.TVGQN.KSLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1238 score:84 alignment:5M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YQKKPQG.S.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1107_003 score:84 alignment:9M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.PQL..L..LY..Q...ATSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1757 score:96 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S.PQL..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2791 score:41 alignment:8M1S[2,3]2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GE.AFVV..G..V..VAGEF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C418_016 score:51 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YQKKPQP.Q.GSL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C665_004 score:41 alignment:1I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QDSNQ.DY..SS..P.LT.F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1518_002 score:50 alignment:1I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALKSA.L.N.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C605_006 score:84 alignment:3I12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YVYY..T.HQGL.SSPVT..K~~~~~
>C614_019 score:39 alignment:1I5M1S[1,2]1M1I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NVQDALAGEEGREQH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1578_012 score:55 alignment:12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL.SL..NN..D.LT.L.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1289_007 score:96 alignment:12M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VFL..FPPSDE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_151 score:55 alignment:2M1S[3,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K.T.QL..PEVFL..TK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1266_005 score:54 alignment:1S[2,2]10M unique:True
~~~NLVMDVTP.KKLF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1972 score:86 alignment:1S[2,2]10M unique:True
~~~NLVMTQTP.KFLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2834 score:41 alignment:1I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KDA.MLL.CGA.ASGV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C405_005 score:84 alignment:6M1S[2,2]4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YQKKPGS.Q.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C450_004 score:35 alignment:1I7M1S[2,1]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AKLQD..P.ELQNV.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3877 score:40 alignment:2I12M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LKDMALAC.GASGV.S~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C856_005 score:44 alignment:3M1I7M1S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QGLLSSLQD..K.TGF~~~
>C627_012 score:66 alignment:2M1S[2,1]2M1I5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFQGTGKLELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1552_009 score:76 alignment:2M1S[2,2]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPQG.S.PQL..L..LY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C106_011 score:76 alignment:2M1S[2,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.HGQL.SSPVT..K~~~~~
>Combined_2041 score:78 alignment:4M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFGAAS.KLELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1156 score:42 alignment:1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DQG.SS.TLQDQK.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1962_013 score:36 alignment:5M1D5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALVNW.VENHL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3570 score:68 alignment:2M1S[2,1]1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFQSA.KLELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1334 score:78 alignment:2M1S[2,1]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFQGT.KLELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1167 score:88 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QKKPGQ.S.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C136_003 score:70 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASGVPDRQYSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2670_003 score:44 alignment:2I7M1S[2,2]2M unique:False
~~~~~~~~~~~~~~~~~~~~~YNSLTLDSYNTL.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_630 score:36 alignment:8M1D2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.T.PDR..L..Q...Q...A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C310_002 score:43 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLSNG.FNQKYW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1908 score:43 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QLL.SLQDT..K.GF~~~~
>Combined_2928 score:78 alignment:4M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QKKPAN.S.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1184_012 score:60 alignment:3M1S[2,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLPAN.S.PQL..L..Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_666 score:66 alignment:1S[2,2]7M1S[2,2] unique:True
~~~NLVMTQTP.KLF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C108_003 score:70 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASGVPDRYQSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_420 score:78 alignment:1S[2,2]9M unique:True
~~~NLVMTQTP.KFL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1630_006 score:51 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TV.TL..SY..D.LT.L.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2506_003 score:37 alignment:1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CEPALQK.GFSGL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2198_005 score:41 alignment:1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QSL..TN..N.LT.L.TLL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2580 score:64 alignment:1S[2,2]2M1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KQKPQG.S.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1927 score:88 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SKAD.YE.KHKVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2043 score:38 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K.LTTQ.SF..SQ..T.V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C446_008 score:34 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GAGGGFGSTRV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1135_005 score:32 alignment:5M1D5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALVNW.VQNHL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2920 score:36 alignment:8M1D2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.T.PDR..Q..L...Q...A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2193_004 score:34 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..SN..T.NN.L.MKKY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1615_006 score:32 alignment:5M1D5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALVDW.VDYTL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C801_008 score:43 alignment:1I9M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ACM.VSLQD..K.TGF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C129_020 score:38 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~EPATGSFRDGS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_968 score:68 alignment:2M1D8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FL...PPSDE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C75_007 score:38 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.T.PNK..A..QA..Q...A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C473_004 score:52 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..L..NNF.Y.PTRNL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C15_009 score:61 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.SSPAT..G.SLGR~~
>Combined_1101 score:88 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFGAGT.KLELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C871_015 score:37 alignment:1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGTGGETRLMAY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1159 score:76 alignment:4M1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QKKPQG.S.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1547_004 score:34 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VFL..FPLYFA.MR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C40_014 score:43 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QAS.SGS.PSVV..R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3540 score:47 alignment:11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TL.SL..NN..D.LT.L.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3308 score:42 alignment:1I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DS..L.LA.E.VKAQ.YE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C395_003 score:43 alignment:11M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLDMALCA.GAS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1059 score:45 alignment:2I11M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LVSL..GD..S.LT.L.TKC~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_984 score:70 alignment:2M1S[3,3]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPSG.Q.PQL..L..LY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C936_014 score:51 alignment:1S[2,2]9M unique:True
~~~NLVVNMTP.KFL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C73_003 score:39 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LY..G...PSDSASR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_638 score:42 alignment:2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CFHQDY.SSPLT..F~~~~~~
>C1715 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~SPWSL.LDQNW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3241 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VCPALQP.VLS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C959_009 score:41 alignment:2I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~HFSESL.LNENM.A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3075 score:56 alignment:1M1S[2,2]1M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PQG.SKPQL..L..LY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3636 score:60 alignment:2M1D7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FL...PPSDE.QL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1839_004 score:43 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~ESHSL.LNENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1258 score:61 alignment:1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSGQ.K.PQL..L..LY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C3707 score:39 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SVV..T..V..V..DLF.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1015_016 score:68 alignment:7M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFGAGT.KELL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1615 score:39 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SL..SL..Y.YT.G.EK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1185 score:42 alignment:2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FCHQDY.SSPLT..F~~~~~~
>Combined_1201 score:80 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C772_014 score:79 alignment:1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GL..FPPSDE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1242_008 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSV.VSVH..C..P..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C92_025 score:43 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~EPATGTGRSM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1923_012 score:53 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.AGLH..C..L..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_476 score:39 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~SPWSL.LNENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3605 score:68 alignment:6M1I4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFGAGTGKLEL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1996 score:80 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFGAGT.KLEL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1527 score:80 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..FPPSDE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3026 score:70 alignment:6M1S[2,2]2M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASV..MA..L..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1498_012 score:79 alignment:1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTFGAGT.KLEL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1359 score:44 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SL..SS..T.LV.Q.KW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1322 score:42 alignment:2I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NVKVDPELQK.VN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3582 score:79 alignment:1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LL..FPPSDE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1249 score:80 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SL..SS..T.LT.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C820_005 score:38 alignment:1I10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LLL.S.SLAE.KE.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C906_002 score:41 alignment:3I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSYHQDY.SSPLT..F~~~~~~
>C386_007 score:39 alignment:1S[1,2]9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GL.T.V.AT..VSRPL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1942_003 score:68 alignment:1S[2,2]8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GST.ASVV..C..L..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C549_009 score:70 alignment:3M1S[2,1]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFGQT.KLEL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1033_003 score:36 alignment:2M1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SLPLLSNG.KDM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1953 score:71 alignment:10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..NNF.Y.PREAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1913_002 score:38 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~ETHSL.LNENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C116_009 score:32 alignment:1I4M2D4M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QV.TVQ..K.DSA~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1286_005 score:52 alignment:1S[3,3]1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTS.GTVV..C..L..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1994 score:70 alignment:1S[2,2]8M unique:True
~~~NLVMTQTP.KF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1906 score:43 alignment:1I10M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CHQDY.SSPLT..F~~~~~~
>C149_011 score:35 alignment:10M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.SDTD.YM.KKY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C387_013 score:36 alignment:1I7M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QPALQD..K.TGF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3620 score:63 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NNF.Y.PREAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3543 score:60 alignment:1S[2,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GST.ASVV..C..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C317_015 score:60 alignment:5M1I4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A..C..E..V..TGHQGL~~~~~~~~~~~~~~~~
>C785_019 score:52 alignment:1I1M1S[2,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KA..SL.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3625 score:61 alignment:2I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MEA..E..E..V..T.HQGL~~~~~~~~~~~~~~~~
>C67_026 score:35 alignment:1S[2,2]7M unique:False
~~~NLVMKDSP.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1377_013 score:68 alignment:4I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASVGK.T.V.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3124 score:35 alignment:1S[2,2]7M unique:True
~~~NLVDLMTP.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C34_016 score:36 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..SL..N.DE.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2916 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.L.SKAD.YE.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C190_033 score:35 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQGS.LHVNV.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1296_012 score:59 alignment:4I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSVSK.S.V.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C625_019 score:48 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GTDFTGVPDR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3619 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GAGT.KLELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1047_012 score:61 alignment:2I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MEA..Q..E..V..T.HQGL~~~~~~~~~~~~~~~~
>C1082_008 score:35 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LNY.AEYRDWY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C111_026 score:35 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GSTA.SG..LS..T.A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C238_025 score:35 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YAYGH..P.TFGH~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1626_011 score:49 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AEGV..L..L..L..NN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C529_018 score:48 alignment:4I2M1D6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSVNK.T...AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C994_014 score:30 alignment:7M1S[2,1] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQL..L.DRGQ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C4_007 score:50 alignment:1S[2,2]1M1S[2,2]4M unique:True
~~~NLVTMQTP.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C978_012 score:52 alignment:2I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KAG.S.V.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1589_010 score:54 alignment:3M1S[3,3]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.S.LPQ..L..LY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3575 score:60 alignment:2M1I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~K.TNV.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C84_020 score:63 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AD.YK.KHKVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1616_009 score:72 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.S.PQL..L..LY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3577 score:40 alignment:1M1S[1,2]7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SLGRYGVHGW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1054_012 score:35 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KA.G.S.LA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1865_011 score:46 alignment:3I1S[1,2]8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~APVVA.A.T.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1509_004 score:71 alignment:1I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GL..FPPSDE.QL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C664_016 score:35 alignment:1I9M unique:False
~~NLPPLTQTP.V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3929 score:54 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A..C..E..V..T.HLGQ~~~~~~~~~~~~~~~~
>Combined_570 score:62 alignment:7M1S[2,2] unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A..C..E..V..T.HQVA~~~~~~~~~~~~~~~~
>Combined_3008 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C..L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_407 score:36 alignment:3M1S[3,3]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SET.VGTV..K..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C354_010 score:53 alignment:1S[2,2]7M unique:True
~~~NLVNTQTP.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1736 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..SS..T.LT.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1143_006 score:35 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HL..SS..V.ML.L.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1174_005 score:36 alignment:1I1S[1,2]6M1S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LGLASAVCDFR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1780 score:35 alignment:1S[2,2]7M unique:False
~~~NLVMSDKP.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C829_009 score:62 alignment:1S[2,2]7M unique:True
~~~QVVMTQTP.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1414_004 score:39 alignment:1S[2,2]7M unique:True
~~~NLVMSELP.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1425_005 score:58 alignment:1I4M2I5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LPQL..LSALY..Q...AS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3259 score:54 alignment:5M1S[3,3]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A..C..E..V..T.GHQL~~~~~~~~~~~~~~~~
>Combined_1932 score:52 alignment:1I1M1S[2,2]6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KG..SL.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C574_005 score:36 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVTGVANAL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3273 score:43 alignment:4M1D4M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LY..Q...A.TRYS~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C809_008 score:62 alignment:1I9M unique:True
~~~~VLMTQTP.KFL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2149 score:34 alignment:2I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DVGV..L..L..L..NNT.A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1666 score:34 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AVLDALLE.GK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1605 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..L..LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C353_012 score:48 alignment:1S[2,2]7M unique:True
~~~NLVNTETP.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2051_002 score:29 alignment:3M1D5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VNW.VENHL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C83_006 score:30 alignment:2M1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.DANL.TRPD~~~~~~~~~
>Combined_631 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A..C..E..V..T.HQGL~~~~~~~~~~~~~~~~
>C79_008 score:31 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.N.AN..PTDRL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C77_006 score:60 alignment:6M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A..C..E..V..T.HGQL~~~~~~~~~~~~~~~~
>C84_007 score:33 alignment:5M1S[2,2]2M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~A..C..E..V..A.QHTV~~~~~~~~~~~~~~~~
>Combined_3710 score:35 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~EPATGTQRM~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2364 score:35 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~EPATGTGRW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2216 score:44 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GPGQ.S.SLD..L..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1149 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AD.YE.KHKVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1098 score:60 alignment:2M1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPQG.S.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C263_004 score:36 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SET.VSAV..K..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C481_005 score:37 alignment:1S[1,2]1M1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GLPQG.S.PQA..N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C489_007 score:62 alignment:2M1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KPAN.S.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1267 score:50 alignment:4I9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSVNK.L.T.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_413 score:33 alignment:1S[2,2]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KL.SAT.ASFL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_496 score:35 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QV.SLQDSK.AF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C226_006 score:36 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.D.AN..PSERL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1157_007 score:34 alignment:1S[1,2]8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AGSL.GHYGR.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined score:62 alignment:1S[2,2]7M unique:True
~~~NLVMTQTP.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1531 score:43 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LSL..SE..T.YD.L.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C137_008 score:35 alignment:1I9M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QNALDG.GLSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2521 score:29 alignment:5M1D3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LA.T.V.R...PTV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C197_002 score:44 alignment:1S[2,2]7M unique:True
~~~NLVMNHTP.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C153_010 score:33 alignment:1S[2,2]7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KL.SAT.ASFK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C127_009 score:40 alignment:9M unique:False
~~~~~~~~~~~~~~~~~~~~EPATGSFRN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1731 score:44 alignment:1S[2,2]7M unique:True
~~~NLVMTNHP.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2517 score:36 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CM.PALQP..V.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1532 score:36 alignment:9M unique:False
~~~~~~~~~~~~~~~LLLPGELAK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2837 score:72 alignment:9M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SGT.ASVV..C..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2247 score:37 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASLV..Q..L..L..G~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2832 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TFGAGT.KL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1368 score:43 alignment:2M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQLS.PQL..L..Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_455 score:38 alignment:1S[2,2]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KL.TGT.ASF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C90_010 score:37 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.SDTD.YE.M~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C780_014 score:34 alignment:3I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VQEPKGPKVQW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C760_020 score:46 alignment:8M unique:True
~~~~~~~TQTP.KGFL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1028_004 score:38 alignment:5M1I3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LK.TGTLASF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3642 score:62 alignment:2I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NST.ASVV..C..L..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_256 score:34 alignment:1S[2,2]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KL.SAT.ASF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C168_011 score:32 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TVV..G..L..T..NK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1568 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GL.SSPVT..K~~~~~~~
>C836_015 score:37 alignment:8M unique:False
~~~~~~~TQTP.NKLF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2034_009 score:46 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LK.SAT.ASF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C253_010 score:32 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..LE..N...AECR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2997 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1071_012 score:52 alignment:1M1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PQG.S.PQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2996 score:59 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..L..DNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2881 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GAGT.KLEL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1104 score:35 alignment:2I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FCHQDY.SSPL~~~~~~~~~~
>Combined_2879 score:53 alignment:2I8M unique:False
~~NGLVMTQTP.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_767 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VSTA.SL..AS..F~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3450 score:32 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QCL.LNENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_568 score:33 alignment:1I5M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QV.TVQDKS.A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C153_021 score:43 alignment:5M1S[2,2]1M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LY..Q...ASRTY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_495 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SSPVT..K.SF~~~
>Combined_2914 score:40 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LS.LNTQE.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C88_024 score:37 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASTAASFK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1097 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CHQDY.SSPL~~~~~~~~~~
>C86_023 score:37 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.STAA.YA.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_411 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLL.SAT.ASF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1161 score:55 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LY..Q...ASTRY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1179 score:63 alignment:1I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GT.V.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C276_004 score:30 alignment:1I5M1S[2,2]1M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VV..W.HCG.VTT~~~~~~~~~~~
>C577_013 score:64 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PPSDE.QLK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1188_002 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GT.V.AA..TGFF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C8_003 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YTNASQRPD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1648 score:33 alignment:1I3M1S[2,2]3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VVVL..PFPSK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C466_002 score:32 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SL.LNENS.M~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C990_006 score:51 alignment:4I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PSVPT.K.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C571_012 score:40 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLL.TGT.ASF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3489 score:32 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QDL.LNENW~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C28_013 score:37 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.SNTD.YE.M~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1183_010 score:36 alignment:1I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KK.SGV.ASFL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C322_024 score:37 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~GSPASLRL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1494 score:49 alignment:6I8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FHGFLTN..L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1690_006 score:37 alignment:4I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~HMTTSDFSSRVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3595 score:54 alignment:1S[2,2]6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGGVPDRF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3429 score:41 alignment:8M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~AEGV..L..L..L..N~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C517_017 score:46 alignment:2M1S[3,3]3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GAKG.TLEL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2590 score:35 alignment:2I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CFHQDY.SSPL~~~~~~~~~~
>Combined_3560 score:46 alignment:8M unique:True
~~~~~~~TQTP.KNFL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2185 score:35 alignment:2I8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DVGV..L..L..L..NNT~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2596 score:38 alignment:2M1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LKLTGT.ASF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C547_005 score:37 alignment:8M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SL..T.TT.L.VK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3207 score:47 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SAVPDRF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1769_010 score:55 alignment:1I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ME..V..T.HQGL~~~~~~~~~~~~~~
>Combined_2777 score:54 alignment:2I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ASV.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C66_025 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VQQKYSN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C63_007 score:36 alignment:2I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SYVQ.KHKVY~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1305 score:56 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~T.L.SKAD.Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C226_009 score:56 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~S..T.LT.L.SK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C510_009 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.LQPVL..K~~~~~~~
>Combined_1170 score:51 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..DNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C854_011 score:51 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..NDF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_110 score:38 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SFNRGEC
>Combined_1831 score:29 alignment:1I5M1S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SLQD..K.TGF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C816_014 score:36 alignment:2I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DVVG..L..L..L..NN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1154 score:56 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GT.KLELK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1861 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SL.LKGNF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C602_009 score:44 alignment:5M1S[2,2] unique:True
~~~~~~~TQTP.KLF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C424_009 score:44 alignment:3I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VSKA.AA..PSVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1903 score:56 alignment:7M unique:True
~~~~~~~TQTP.KFL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1147 score:56 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LY..Q...ASTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_156 score:36 alignment:2I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~MFL.SFPTT..K~~~~~~~
>Combined_454 score:51 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGVPDRF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C439_012 score:39 alignment:5M1S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGVPDFR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C9_007 score:56 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SFGRNEC
>C354_023 score:55 alignment:1I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PE..V..T.HQGL~~~~~~~~~~~~~~
>Combined_2648 score:42 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E..T.LT.L.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C822_012 score:44 alignment:4M1I3M unique:False
~~~~~~~TQTPGKFL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_112 score:55 alignment:1I7M unique:False
~~~~LVMTQTP.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1634 score:37 alignment:1I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FL.SFPTT..K~~~~~~~
>Combined_2775 score:36 alignment:2I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLASTLASF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C557_013 score:38 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GT.KLEQL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1593 score:38 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L.SFPTT..K~~~~~~~
>C1839_010 score:38 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PFLAKVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_691 score:36 alignment:2I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DVGV..L..L..L..NN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2588 score:56 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C92_013 score:38 alignment:7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ELQ.T.V.AR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_353 score:30 alignment:5M1S[2,2] unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LQD..K.TGF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_293 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VQEKSYN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C89_015 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~TGMWGT.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1746 score:50 alignment:1I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YTGVPDRF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C191_014 score:30 alignment:2I1S[2,2]5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~SQAN.S.PEL..R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_351 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VQQKSYN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C92_018 score:33 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GQ.T.PDK..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2712 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L..NN..N.LT.L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2109 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GFNPLSR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C126_004 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GT.KLKPN~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1791_008 score:46 alignment:1S[2,2]5M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QVNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C1624_006 score:29 alignment:7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GL.W.HQL..L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1904 score:36 alignment:2I7M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LKASTLASF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3571 score:55 alignment:1I7M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GL..NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3517 score:29 alignment:1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KSVV..C..N..Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C141_015 score:30 alignment:6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~GHYRYG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1162 score:48 alignment:6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C2014_002 score:25 alignment:6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DFLHMV~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_124 score:33 alignment:1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LL..ES..T.LK~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C489_021 score:36 alignment:3M1I3M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NNFGY.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C325_018 score:46 alignment:2I6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~PCV..T.HQGL~~~~~~~~~~~~~~
>Combined_3594 score:43 alignment:6M unique:True
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DNF.Y.PR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_2875 score:30 alignment:6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KYD.NE.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_067 score:42 alignment:1I6M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YTGVPDR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C124_002 score:29 alignment:2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~QLQ...ALTR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3163 score:29 alignment:2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LMLAKVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3511 score:27 alignment:2M2I3M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VTWGK.SF~~~~
>Combined_1997 score:29 alignment:2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~NTLAKVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C268_003 score:29 alignment:2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LKLAKVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C187_009 score:37 alignment:3I5M unique:False
~~~~LSCTQTP.K~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>C162_007 score:38 alignment:2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~YGGVPDR~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_314 score:29 alignment:2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~FPLAKVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_251 score:29 alignment:2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~LALAKVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_1991 score:29 alignment:2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ALLAKVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~
>Combined_3561 score:29 alignment:2I5M unique:False
~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KLLAKVF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~

Template Sequence

DINVMTQTPKFLLVTPGEPASISCRSSQSLLHSNGYNYLDWYQKKPGQSPQLLIYQASTRASGVPDRFGSRRYGTDGSTFISRVEAEDVGVYYCMQALQTPTFGAGTKLEIKTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPRLAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFGRNEC

Recombined Template REC-0-1_002

Consensus Sequence

Annotated Consensus Sequence

Annotated Consensus Sequence (TXT)

Preview

Sequence Consensus Overview

Sequence Consensus Overview (TSV)

Preview

Variant Graph

Higher Order Variant Graph

Depth of Coverage of the Consensus Sequence?BargraphThe depth of coverage reported is the sum of all positional scores for that position. This is reported with the same position numbering as the consensus sequence.

Bargraph

Depth of Coverage of the Consensus Sequence (TSV)

Preview

Scores

Length

Score

Matches

Unique Score

Unique Matches

Order

Alignment

Reads Alignment (FASTA)

Preview

Combined

Combined_009

Combined_091

C116

Combined_038

Combined_044

Combined_067

C61_002

Combined_225

C910

C62

C119

C121_002

Combined_3132

C224_002

C668

C723

Combined_221

C507

C704

Combined_171

Combined_110

C73_003

Combined_112

C108_003

C124_002

C143_003

C144_002

Combined_088

Combined_124

Combined_1731

C191_004

Combined_1102

C347

Combined_1751

C465

Combined_150

Combined_151

Combined_1531

Combined_1532

Combined_155

C619

Combined_156

Combined_212

Combined_182

Combined_172

Combined_1277

C1289

Combined_169

C1374

C1447

Combined_1712

C1466

C1494

C136_003

C182

Depth of Coverage of the Consensus Sequence